SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0305312 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0305312
Domain Number 1 Region: 26-236
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.75e-59
Family BAR domain 0.00000000255
Further Details:      
 
Domain Number 2 Region: 433-501
Classification Level Classification E-value
Superfamily SH3-domain 7.88e-17
Family SH3-domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0305312   Gene: FBgn0027356   Transcript: FBtr0333099
Sequence length 502
Comment pep:known chromosome:BDGP5:2R:8481109:8499573:1 gene:FBgn0027356 transcript:FBtr0333099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTENKGIMLAKSVQKHAGRAKEKILQNLGKVDRTADEIFDDHLNNFNRQQASANRLQKEF
NNYIRCVRAAQAASKTLMDSVCEIYEPQWSGYDALQAQTGASESLWADFAHKLGDQVLIP
LNTYTGQFPEMKKKVEKRNRKLIDYDGQRHSFQNLQANANKRKDDVKLTKGREQLEEARR
TYEILNTELHDELPALYDSRILFLVTNLQTLFATEQVFHNETAKIYSELEAIVDKLATES
QRGSNTLRKQTSNPIKTSSPVQSPVNKLNNANINSNYQNQITTNGGSSLANSQPRPESPA
AALVSATPSSPVENGVTTKSLERPELSGLNASAKATTTTQTSPTEDKAVVSEAVKPSETE
GAAVAASVTPAPPATPAQINGNNNEPSIVKEGGKQPKELPSTTSNAEAAAEAAANNGNSI
EEHKQKKLDANTADLPPGVLYRVKATYGYAKEDVDELSFEIGDLIRVIEYDDPEDQEEGW
LMGQKEGTNEKGLFPANFTRPI
Download sequence
Identical sequences A0A0B4KEW6
FBpp0305312 NP_001260919.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]