SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0305313 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0305313
Domain Number 1 Region: 26-236
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.11e-58
Family BAR domain 0.00000000255
Further Details:      
 
Domain Number 2 Region: 304-373
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000263
Family SH3-domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0305313   Gene: FBgn0027356   Transcript: FBtr0333100
Sequence length 373
Comment pep:known chromosome:BDGP5:2R:8481109:8499573:1 gene:FBgn0027356 transcript:FBtr0333100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTENKGIMLAKSVQKHAGRAKEKILQNLGKVDRTADEIFDDHLNNFNRQQASANRLQKEF
NNYIRCVRAAQAASKTLMDSVCEIYEPQWSGYDALQAQTGASESLWADFAHKLGDQVLIP
LNTYTGQFPEMKKKVEKRNRKLIDYDGQRHSFQNLQANANKRKDDVKLTKGREQLEEARR
TYEILNTELHDELPALYDSRILFLVTNLQTLFATEQVFHNETAKIYSELEAIVDKLATES
QRGSNTLRKQTSNPIKTSSPVQSPVNKLNNANINSNYQNQITTNGGSSLANSHANTADLP
PGVLYRVKATYGYAKEDVDELSFEIGDLIRVIEYDDPEDQFFIANLQEEGWLMGQKEGTN
EKGLFPANFTRPI
Download sequence
Identical sequences A0A0B4KFR7
FBpp0305313 NP_001260920.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]