SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0305326 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0305326
Domain Number 1 Region: 206-344,394-520
Classification Level Classification E-value
Superfamily L domain-like 1.53e-18
Family Internalin LRR domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0305326   Gene: FBgn0001189   Transcript: FBtr0333115
Sequence length 611
Comment pep:known chromosome:BDGP5:X:1563603:1567641:1 gene:FBgn0001189 transcript:FBtr0333115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAYTHGTWLLLLLLLVAGACARPEIAHTPDPAALGEESTPHAHAHPQARHHHHAHPHAP
LKEDEQGTAIPAPILTTDNVGIGETTTASSLAETQSMSDPGSVTDTTSTSTSHSTSTTST
TSPAPLPPAAPEQPEYLKHCFYAEEQLCGHTFDGRAETSEGQGSTVAQSEAQNRGGQGNS
QCQCREHPTRPNSWYCCNISQLTMISSCSNISKWTNLHVRNMTVEDMDLSNPIFRSLQSL
AVTDGNITRLVNAFPRLSALKCLNISNNNISEIHSRAVKDVPHLEFFGMSNNNLSLVPHR
NQNKNITLDISGNMRMLCTPLNEIIYTESINFLNPKHSYCQYNATHTWFQSTDKVSVEQL
ENRKRCVTNCPVIPNYGSCNCTLENIMIIQDNQSKPQCHVDCSNLGLVELPQRLPDNTFM
LNITNNKITSLGDYFHTNPTYHNINRLLADNNQISSIYEFEGTKFIETFQRIYMRNNSLS
KIPEYFLNNALMDSGLGRRIYLAGNKLQCDCNSAKTLQNWLKERSSDIPDYMEIRCRNMP
QRVIELQEAKLCQSPPDWTDYIYYLIAAEVLLLLALITKVSYDYWVFKTAGYLPWPASKM
PKLPCDWLCES
Download sequence
Identical sequences B6IDK2 Q9W568
7227.FBpp0070260 FBpp0070260 FBpp0305326 FBpp0070260 FBpp0070260 NP_001259135.1.81976 NP_569933.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]