SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0305372 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0305372
Domain Number 1 Region: 101-243
Classification Level Classification E-value
Superfamily Hypothetical protein c14orf129, hspc210 1.31e-37
Family Hypothetical protein c14orf129, hspc210 0.005
Further Details:      
 
Domain Number 2 Region: 1063-1139
Classification Level Classification E-value
Superfamily TPR-like 0.0000000176
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 
Domain Number 3 Region: 942-1054
Classification Level Classification E-value
Superfamily TPR-like 0.000000949
Family Tetratricopeptide repeat (TPR) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0305372   Gene: FBgn0034087   Transcript: FBtr0333169
Sequence length 1289
Comment pep:known chromosome:BDGP5:2R:12075394:12081782:1 gene:FBgn0034087 transcript:FBtr0333169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELVQEIHQLLMDREETCHRTCFSLQLDNVTLDNFAELKSINNLEQGSTIKVVEEPYTMR
EARIHVRHVRDLLKNLDPADAYNGIDCTSLTYLNTITQGDLLDKKRTRPDSVDCTPPEYV
TPGVSDPPILPLHPNVKNAKGPQALKVLTTSAWNPPPGPRKLHGDLMYLYVVTMEDKRFH
ISACSKGFFINQSTDDTFNPKPDNPSHLSHSLIDLLSHISPSFRRAFQTIQKRRTMRHAF
ERVATPYQVYQWAAPILEHTVDAIRAEDAFSSKLGYEEHIPGQTRDWNEELQTTRELPRK
TLPERLLRERAIFKVHGDFVTAATRGAMAVIDGNVLAINPGEDTKMQMFIWNNIFFSMGF
DVRDHYKELGGDAAAFVAPRYDLHGVRVYNAVDIEGLYTLGTVVVDYRGYRVTAQSIIPG
ILEREQEQSVVYGSIDFGKTVLSHPKYLELLRQAGKHLKILPHVVLNERDEPVELCSSVE
CKGIIGNDGRHYILDLLRTFPPDVNFLKLQDVQLSKELVDMGFPIEHRHKLCCLRQELLE
AFIEDRHVNFIRIAAARLQQLTTIKQSEKSEANPVPALEGAEAASKVNGAEKPDDKEKKN
EEEEKKERSTSGEARAAAIVNAIREAQSNVATSNEVQAAEVVKRACAAVGSLKEKEFDFR
FNPDVFSPGIRHADGEEGTSLAKQKVLVQEAAEFLVLKQIPAFIKEHMSHSSSPIDGQSL
TESLHSHGINVRYLGKVIKILSQMPRMDYLHRIAVLELIVRATKHIYYTYMQNTEPLHLS
AAISHFLNCLLTNGPVNPAVSSEEAHKKRGNGGKHNKHKSSKGGKGQQQQQTTGNQNGSS
SGSSNSSSASDWTLMTPRSLWQQIRKEAKVYWDWELDCDSIETAVSKYGILRISLMRAFC
LKVGIQVLLREYNFESKHKPTFGDDDIVNVFPIVKHISPRATDAYNFYTTGQAKIQQGLF
KEGYELISGALNLLNNVFGALHQENGSCLRMLARLSYLLGDAQDALAIQQRAVIMSERVN
GMDHPSTILEYTHLSLYSFANGHVGMSLKLLYRARYLMVLICGEDHPEVALIDSNISLIL
HALGEYELSLRFIEHALKLNLKYFGDKDMHVALSYHLMARTQSCMGDFRSALNNEKETYS
FYKSQLGENHEKTRDSAECLRLLTQQAVLLQRKMNDIYSSGKLTSDLPPIHITPPSMGSV
LDMLNTINGILFVKISRKDIVKVRSEIEKHFKTDSTENEVNDAINSIVAAANNNGEAEDA
VSKDIKEQPEAGKQLTNGDKAAATEATSS
Download sequence
Identical sequences A0A0B4KEX0
NP_001261021.1.81976 FBpp0305372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]