SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0305379 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0305379
Domain Number 1 Region: 678-1051
Classification Level Classification E-value
Superfamily L domain-like 7.82e-52
Family Ngr ectodomain-like 0.014
Further Details:      
 
Domain Number 2 Region: 457-737
Classification Level Classification E-value
Superfamily L domain-like 2.01e-50
Family Internalin LRR domain 0.019
Further Details:      
 
Domain Number 3 Region: 1038-1334
Classification Level Classification E-value
Superfamily L domain-like 1.62e-41
Family Ngr ectodomain-like 0.0073
Further Details:      
 
Domain Number 4 Region: 278-524
Classification Level Classification E-value
Superfamily L domain-like 4.19e-30
Family Internalin LRR domain 0.016
Further Details:      
 
Weak hits

Sequence:  FBpp0305379
Domain Number - Region: 1386-1432,1483-1511
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000186
Family Fibronectin type III 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0305379   Gene: FBgn0259677   Transcript: FBtr0333177
Sequence length 1817
Comment pep:known chromosome:BDGP5:X:22234235:22286070:1 gene:FBgn0259677 transcript:FBtr0333177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCRGRNLRTSAALVNLLAKCTKSTNGQAAVLAKDKESENRENLVPQKQRAQRQNKQQQHP
QQYPQMMQQQQQQQQQQRQEQHQEQHNQRQQQGRQIEQMAMGTNAEAAAAKKHKHQTKPT
DSECEGKHKHKRNRNNVAGVQQHVLRLKLELQLLLCALLPTALLLGLLPLPPGAAATAMI
SSAKGSVRELLLTEMGGGGVGVGVGGSSGGAAHPAGGGPGTGLAGGDGGGAAGIECPSFD
NTACPCYKFEDGLFLECPGTTAISLRSTLERISAPIHSLSIYDFDRSVTSLSQDVFQPGV
HIRHLQFSHSHLEALKDNSLRNVRSSLESLSIVNGKLTQMPSRALSSMQKLTALDFDYNE
IVRVDDYSFYGLRISKLNMKGNRLQGMPEHAFAGLEECMQEIDVSENGLRTFPLMALRKL
DHLRILRLSNNRIPTFYGDIQLATNNASAAAAAVGAFQLPSLIFLDLSSNQFAEIGPDCF
RAFPQLKTLSFYANQIELVQPEAFKSLRELMSLDMSHNRIIGLDPKVFEKNKRLQTVDLS
HNHIHTIGGVFSNLPQLREVFLSENNILELPADAFTNSTNVDVIYLESNAIAHIDPNVFS
TLVNLDHLYLRSNFIPLLPVTLFDKSTKLTSLSLDNNEIQDLEIGMFRKLEHLREVRLHN
NRIRRVRRGVFEPLPSLQELHIQKNSIEDIEPQAFHTLENMQHINLQDNQLTVLEDIFPD
ENSSLLSVQLEANYLHKVHPRTFSRQQKVQIMWLKDNQLTRVERSFFADTPQLGRLYLSD
NKIRDIEKDTFVNLLLLQFLDLSGNQLRQLRRDYFAPLQDLEELSLARNHIEAIEGYAFA
KLKNLKSLDLSHNPLVQLTRDIFSNEFPLNSLNLGNCSLRKLEQHAFKSLTNLNELNLER
NQLNPADIQTLDIPNLRRLLLSHNNFSYAGSVGIMAGMLDRLRSLQQLSMSNCSLGQIPD
LLFAKNTNLVRLDLCDNRLTQINRNIFSGLNVFKELRLCRNELSDFPHIALYNLSTLESL
DLARNQLASIDFFKLSGTLNLRQLILRDNKITALSGFNAVNLTQLDSVDLSGNLLLSLPA
NFLRHSINLQKVHLSNNRFLQIPSSALSDVSIPRLSWLNLTGNPINRIYTVKEERYPYLK
ELYICQTNLSILTSKDFEAFQALQHLHLVNNRITRISPGAFKSLTNLLTLDLSVNELEML
PKERLQGLRLLRFLNISHNTLKDLEEFSVDLLEMQTLDLSFNQLDRISKKTFRNLHGLLE
LFLMGNRMTVLSNDAFRFLRKLHVLDLRKNYFELVPLEPLRPLETNLRTLRLEENPLHCS
CDAQKLWEWLRDHRKWSLSMGSGAGRGIGGLTGGLGGDSINYLRCEHPTELRGKVFGRME
PQQFCDAPLIPKMAIQDIQPYSVVVSWQSRDHLGLNGFEIVYHATGDGLVTAGSPTSRER
DSLRDIHDPERQRTRDQARERSRERDRDRERDRERFSIATDEIHGKRLNGTASSTKLTKL
SPNTRYHICVIGSGNWLSEPLANALQRLHTNESLREEEAVMMSAPLPESFSPYQHQHNRN
SNGNANPAMVQDHNKKQNPDQDLDNVVGQDNALMEVLKNSHISACTDVQTLDSTPSLVTD
ENGLSSNGFIHSILTRRLGLIVGCCLGIIVFIVMISVLSYVKLKKKRIENAKRQAALPPE
YISYRHFSIPNEELTRTAANAGTVAAAAAANNSHNSNNSTDEGSSPHMSSVPSGISAHIS
GTSLSTGGTGTGSTTTTATTPIGGVPLGKAGSTLVGVGLVVADSSVDVGYAHNHAHAHAH
RHMAAGVVLNTNHLSVC
Download sequence
Identical sequences Q0KHN6
NP_001036303.2.81976 NP_001036306.3.81976 FBpp0305379 FBpp0305380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]