SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0305491 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0305491
Domain Number 1 Region: 600-861
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.85e-79
Family Protein kinases, catalytic subunit 0.00000145
Further Details:      
 
Domain Number 2 Region: 13-286
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.84e-38
Family FCH domain 0.01
Further Details:      
 
Domain Number 3 Region: 498-627
Classification Level Classification E-value
Superfamily SH2 domain 8.75e-23
Family SH2 domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0305491   Gene: FBgn0000723   Transcript: FBtr0333296
Sequence length 872
Comment pep:known chromosome:BDGP5:3R:5193325:5220268:-1 gene:FBgn0000723 transcript:FBtr0333296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFSSALQSRAAHEALIVRQDAELRLMETMKRSIQMKAKCDKEYAISLTAVAQQGLKIDR
ADEMQGSLISKSWRSYMDELDHQAKQFKFNAEQLEVVCDKLTHLSQDKRKARKAYQEEHA
KIAARLNHLTDEVVRKKSEYQKHLEGYKALRTRFEENYIKAPSRSGRKLDDVRDKYQKAC
RKLHLTHNEYVLSITEAIEVEKDFRNVLLPGLLEHQQSVQESFILLWRNILQEAAQYGDL
TADKYKEIQKRIDTVIGSINPTEEYGEFTEKYKTSPTTPLLFQFDETLIQDIPGKLQSST
LTVDNLTVDWLRNRLQELEGAVRDCQEKQMKMIEHVNGGSPVANGSIISNGSNTSNGIQS
NKDSLCRQSKDLNALRCQEKQKQKLVDMIKCALNEVGCEELPSGCDDDLTLEQNFIENGY
NNEQQQRSNSTSSPGLGIMNELMRRGGVLTLLRGRGRHFKRKSTPQPATPMTRSRQGRFN
KLQPRSQSLGSLSISLSTNRPLYEEEWFHGVLPREEVVRLLNNDGDFLVRETIRNEESQI
VLSVCWNGHKHFIVQTTGEGNFRFEGPPFASIQELIMHQYHSELPVTVKSGAILRRPVCR
ERWELSNDDVVLLERIGRGNFGDVYKAKLKSTKLDVAVKTCRMTLPDEQKRKFLQEGRIL
KQYDHPNIVKLIGICVQKQPIMIVMELVLGGSLLTYLRKNSNGLTTRQQMGMCRDAAAGM
RYLESKNCIHRDLAARNCLVDLEHSVKISDFGMSREEEEYIVSDGMKQIPVKWTAPEALN
FGKYTSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARERIDTGYRMPTPKSTPEEMYRLM
LQCWAADAESRPHFDEIYNVVDALILRLDNSH
Download sequence
Identical sequences A0A0B4KFK7
FBpp0305491 NP_001262412.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]