SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0305501 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0305501
Domain Number 1 Region: 15-147
Classification Level Classification E-value
Superfamily Bromodomain 5.63e-43
Family Bromodomain 0.00019
Further Details:      
 
Domain Number 2 Region: 480-594
Classification Level Classification E-value
Superfamily Bromodomain 1.11e-39
Family Bromodomain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0305501   Gene: FBgn0004656   Transcript: FBtr0333309
Sequence length 1115
Comment pep:known chromosome:BDGP5:X:7942563:7952391:-1 gene:FBgn0004656 transcript:FBtr0333309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSEPPPRYEPPVEPVNGIVQPPVIPPAERPGRNTNQLQYLIKTVMKVIWKHHFSWPFQ
QPVDAKKLNLPDYHKIIKQPMDMGTIKKRLENNYYWSAKETIQDFNTMFNNCYVYNKPGE
DVVVMAQTLEKVFLQKIESMPKEELELEPVTAKGGKKKQRAPATPKSSSGGAGASTGSGT
SSAAVTSGPGSGSTKVSVAASSAQQSGLQGATGAGGGSSSTPGTQPGSGAGGAIAARPVS
AMGGTVSSTAGGAPSIPPISTMPPHTVPGSTNTTTTAMAGGVGGPGAAGANPNAAALMAS
LLNAGQTGAYPGAPGQTAVNSSSLLDGSTAAVAAAAAAAAAAAAAAGGAAGAAGGAGTIP
AVAVNAANAVQAYVNAGVSVGVDAVIPPQQPAKIKKGVKRKADTTTPTANAFESPYTQMD
SKSAKIATRRESNRQVIGKKDLTFQGSGYNMSPLGVSGVPGLGGLVAGGVAGVAVAKNKE
KLSDALKSCNEILKELFSKKHSGYAWPFYKPVDAEMLGLHDYHDIIKKPMDLGTVKRKMD
NREYKSAPEFAADVRLIFTNCYKYNPPDHDVVAMGRKLQDVFEMRYANIPDEPVANAAHH
HGHGHGHGHGHGHGHGHGHGHGHGHGYGGSSSLKHDASDSSSEDSSDTENESNSDEERSA
RLKMLESKLLGLQEEIRKLSEEASAKKKAKKKLKEKKKSIGGGSGSGSASHHCHATGGGA
NAGGAGGPGSGGHGSVSVPGGVGSLGPGGAGGANLNALLGGSLVGHGGAAVAGGVPNVGA
LHSQVHDVAMAFSQMAGGGAAAGAGFGAGVTAAGASSGGKAGTLAGALAAGAAAGAGGTT
AGSGSSKGAKSKGGRGAKGSGAGGVGASNNAAAGNAAGGAAGAAAGAGSVGGVGGAGAAG
GGNASKRAKGSSSAGAGGGVGGANASAGGAGARGSSKKKPSQVMNFDSEEEDTAKPMSYD
EKRQLSLDINKLPGDKLGRVVHIIQNREPSLRDSNPDEIEIDFETLKPSTLRELESYVAS
CLRKKTRKPYYKKPSGKSKDEQMAEKKQELEKRLQDVTGQLGASKKTAKKDESASSKVEA
VQPANPVSSSSSSSDSSSSSSSDSSSSDSSDSEAG
Download sequence
Identical sequences M9PGM8
FBpp0305501 NP_001259323.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]