SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0305541 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0305541
Domain Number 1 Region: 183-229
Classification Level Classification E-value
Superfamily RING/U-box 0.000000269
Family RING finger domain, C3HC4 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0305541   Gene: FBgn0031848   Transcript: FBtr0333349
Sequence length 235
Comment pep:known chromosome:BDGP5:2L:6676649:6677625:-1 gene:FBgn0031848 transcript:FBtr0333349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELVKRGFLRACKNHSYLSFELIDDILAPLCANHKTTKPGSKEAIRALVAEINDTISDLG
QLLVFIKYPVKAEEYLVYAKTDATPDSVANTGLTAEECQYFSKLLDKIASEEDCHIAWND
AYNDIVLQASSKPLKKSRMQELLQKWIQMGYFMEVTDRIYLGPRSLVELSFYLSSNHADN
IKNCTLCKCLVLWDIRCGSCNIQYHRGCIQTYLQRRDICPSCGNLWTTPIRRSIG
Download sequence
Identical sequences M9PCC6 Q9VMA0
NP_001260145.1.81976 NP_609063.1.81976 FBpp0078948 FBpp0305541 7227.FBpp0078948 FBpp0078948 FBpp0078948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]