SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0305589 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0305589
Domain Number 1 Region: 245-289
Classification Level Classification E-value
Superfamily RING/U-box 7.9e-18
Family RING finger domain, C3HC4 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0305589   Gene: FBgn0035233   Transcript: FBtr0333397
Sequence length 299
Comment pep:known chromosome:BDGP5:3L:1558782:1559863:1 gene:FBgn0035233 transcript:FBtr0333397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFRNARARQPEIVRSVQKDARYTNELAEDLSDVLRLTGPRNWIKYNQMCRLLAELSYHG
FASANNLQTLGEEYTGIIQVDGNYKQIPSRLLQLIAIVLEFGGDSLFQRLMQKLDTYVAN
NDEIRTEIKPQLKKIIQRLRQSPSYVKALHKSLFYLDASKYQLSKRTTGINYVLIRHWLQ
PEFSLYGYKILGVITFLQVSVSLAISGWDAWREHKRQQLESIKQAGKNFLQRSSSTKDVD
PNTPQCILCLEPRSDSSLTPCGHIFCWSCLLEWLEERDECPLCRESLKKSQVILLQNYA
Download sequence
Identical sequences Q9W0D7
7227.FBpp0072626 FBpp0072626 NP_001261265.1.81976 NP_647624.1.81976 FBpp0072626 FBpp0305589 FBpp0072626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]