SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0305600 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0305600
Domain Number 1 Region: 79-152
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.79e-16
Family Splicing factor U2AF subunits 0.00046
Further Details:      
 
Weak hits

Sequence:  FBpp0305600
Domain Number - Region: 16-40
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000458
Family CCCH zinc finger 0.0052
Further Details:      
 
Domain Number - Region: 152-175
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00406
Family CCCH zinc finger 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0305600   Gene: FBgn0017457   Transcript: FBtr0333408
Sequence length 264
Comment pep:known chromosome:BDGP5:2L:292959:294681:-1 gene:FBgn0017457 transcript:FBtr0333408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRIHNKPTFSQTVLLQNLYVNPQNSAK
SADGSHLVANVSDEEMQEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFR
NEADAEKAANDLNNRWFGGRPVYSELSPVTDFREACCRQYEMGECTRSGFCNFMHLKPIS
RELRRYLYSRRRRARSRSRSPGRRRGSRSRSRSPGRRGGGRGDGVGGGNYLNNERDNMRG
NDRGNDRDRRKGGGGGGGGGGGRY
Download sequence
Identical sequences A0A1W4V460 M9PBM1 Q94535
FBpp0077792 7227.FBpp0077792 NP_001259814.1.81976 NP_477208.1.81976 XP_017046314.1.74164 FBpp0077792 FBpp0305600 FBpp0077792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]