SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0305638 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0305638
Domain Number 1 Region: 21-119
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.00000000000000782
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0305638   Gene: FBgn0027082   Transcript: FBtr0333447
Sequence length 123
Comment pep:known chromosome:BDGP5:3L:2650161:2651850:-1 gene:FBgn0027082 transcript:FBtr0333447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKASRIFCPALITPKNAVVKQTEQLSRSQKLLTELGLVKSGSNGTYQIMPMAQRSVDKC
IDLVQSNMQQAGGQKITLPILTPTGLWKKTGRLDGDISEFYMVRDRSGKQFLMSPVREPT
RRQ
Download sequence
Identical sequences M9PBJ9
FBpp0305638 NP_001261337.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]