SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0305670 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0305670
Domain Number 1 Region: 366-469
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.66e-29
Family Chaperone J-domain 0.00023
Further Details:      
 
Domain Number 2 Region: 18-114
Classification Level Classification E-value
Superfamily TPR-like 1.74e-26
Family Tetratricopeptide repeat (TPR) 0.00066
Further Details:      
 
Domain Number 3 Region: 249-368
Classification Level Classification E-value
Superfamily TPR-like 8.23e-25
Family Tetratricopeptide repeat (TPR) 0.0012
Further Details:      
 
Domain Number 4 Region: 144-247
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000011
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0305670   Gene: FBgn0032586   Transcript: FBtr0333486
Sequence length 478
Comment pep:known chromosome:BDGP5:2L:16501918:16507350:1 gene:FBgn0032586 transcript:FBtr0333486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNKLYMSSEEFTFLPRIAEEKKKLGNDQYKAQNYQNALKLYTDAISLCPDSAAYYGNRA
ACYMMLLNYNSALTDARHAIRIDPGFEKAYVRVAKCCLALGDIIGTEQAVKMVNELNSLS
TAVAAEQTAAQKLRQLEATIQANYDTKSYRNVVFYLDSALKLAPACLKYRLLKAECLAFL
GRCDEALDIAVSVMKLDTTSADAIYVRGLCLYYTDNLDKGILHFERALTLDPDHYKSKQM
RSKCKQLKEMKENGNMLFKSGRYREAHVIYTDALKIDEHNKDINSKLLYNRALVNTRIGN
LREAVADCNRVLELNSQYLKALLLRARCYNDLEKFEESVADYETALQLEKTPEIKRMLRE
AKFALKKSKRKDYYKILGIGRNASDDEIKKAYRKKALVHHPDRHANSSAEERKEEELKFK
EVGEAYAILSDAHKKSRYDSGQDIEEQEQADFDPNQMFRTFFQFNGGGRNNSSFNFEF
Download sequence
Identical sequences M9PDJ9
FBpp0305670 NP_001260500.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]