SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0305701 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0305701
Domain Number 1 Region: 939-1023
Classification Level Classification E-value
Superfamily Kix domain of CBP (creb binding protein) 1.44e-34
Family Kix domain of CBP (creb binding protein) 0.0000207
Further Details:      
 
Domain Number 2 Region: 1689-1809
Classification Level Classification E-value
Superfamily Bromodomain 8.11e-34
Family Bromodomain 0.0000025
Further Details:      
 
Domain Number 3 Region: 503-596
Classification Level Classification E-value
Superfamily TAZ domain 2.88e-26
Family TAZ domain 0.0000745
Further Details:      
 
Domain Number 4 Region: 2381-2465
Classification Level Classification E-value
Superfamily TAZ domain 2.35e-22
Family TAZ domain 0.00000499
Further Details:      
 
Domain Number 5 Region: 2302-2362
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000271
Family ZZ domain 0.0016
Further Details:      
 
Weak hits

Sequence:  FBpp0305701
Domain Number - Region: 2800-2844
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 0.000114
Family Nuclear receptor coactivator interlocking domain 0.0027
Further Details:      
 
Domain Number - Region: 1892-1932
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000249
Family PHD domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0305701   Gene: FBgn0261617   Transcript: FBtr0333521
Sequence length 3266
Comment pep:known chromosome:BDGP5:X:9559706:9580691:-1 gene:FBgn0261617 transcript:FBtr0333521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMADHLDEPPQKRVKMDPTDISYFLEENLPDELVSSNSGWSDQLTGGAGGGNGGGGASGV
TTNPTSGPNPGGGPNKPAAQGPGSGTGGVGVGVNVGVGGVVGVGVVPSQMNGAGGGNGSG
TGGDDGSGNGSGAGNRISQMQHQQLQHLLQQQQQGQKGAMVVPGMQQLGSKSPNLQSPNQ
GGMQQVVGTQMGMVNSMPMSISNNGNNGMNAIPGMNTIAQGNLGNMVLTNSVGGGMGGMV
NHLKQQPGGGGGGMINSVSVPGGPGAGAGGVGAGGGGAVAANQGMHMQNGPMMGRMVGQQ
HMLRGPHLMGASGGAGGPGNGPGGGGPRMQNPNMQMTQLNSLPYGVGQYGGPGGGNNPQQ
QQQQQQQQLLAQQMAQRGGVVPGMPQGNRPVGTVVPMSTLGGDGSGPAGQLVSGNPQQQQ
MLAQQQTGAMGPRPPQPNQLLGHPGQQQQQQQQPGTSQQQQQQQGVGIGGAGVVANAGTV
AGVPAVAGGGAGGAVQSSGPGGANRDVPDDRKRQIQQQLMLLLHAHKCNRRENLNPNREV
CNVNYCKAMKSVLAHMGTCKQSKDCTMQHCASSRQILLHYKTCQNSGCVICYPFRQNHSV
FQNANVPPGGGPAGIGGAPPGGGGAGGGAAGAGGNLQQQQQQQQQQQQNQQPNLTGLVVD
GKQGQQVAPGGGQNTAIVLPQQQGAGGAPGAPKTPADMVQQLTQQQQQQQQQVHQQQVQQ
QELRRFDGMSQQVVAGGMQQQQQQGLPPVIRIQGAQPAVRVLGPGGPGGPSGPNVLPNDV
NSLHQQQQQMLQQQQQQGQNRRRGGLATMVEQQQQHQQQQQQPNPAQLGGNIPAPLSVNV
GGFGNTNFGGAAAGGAVGANDKQQLKVAQVHPQSHGVGAGGASAGAGASGGQVAAGSSVL
MPADTTGSGNAGNPNQNAGGVAGGAGGGNGGNTGPPGDNEKDWRESVTADLRNHLVHKLV
QAIFPTSDPTTMQDKRMHNLVSYAEKVEKDMYEMAKSRSEYYHLLAEKIYKIQKELEEKR
LKRKEQHQQMLMQQQGVANPVAGGAAGGAGSAAGVAGGVVLPQQQQQQQQQQQQQGQQPL
QSCIHPSISPMGGVMPPQQLRPQGPPGILGQQTAAGLGVGVGVTNNMVTMRSHSPGGNML
ALQQQQRMQFPQQQQQQPPGSGAGKMLVGPPGPSPGGMVVNPALSPYQTTNVLTSPVPGQ
QQQQQFINANGGTGANPQLSEIMKQRHIHQQQQQQQQQQQQGMLLPQSPFSNSTPLQQQQ
QQQQQQQQQQQATSNSFSSPMQQQQQGQQQQQQKPGSVLNNMPPTPTSLEALNAGAGAPG
TGGSASNVTVSAPSPSPGFLSNGPSIGTPSNNNNNSSANNNPPSVSSLMQQPLSNRPGTP
PYIPASPVPATSASGLAASSTPASAAATCASSGSGSNSSSGATAAGASSTSSSSSAGSGT
PLSSVSTPTSATMATSSGGGGGGGGNAGGGSSTTPASNPLLLMSGGTAGGGTGATTTTST
SSSSRMMSSSSSLSSQMAALEAAARDNDDETPSPSGENTNGSGGSGNAGGMASKGKLDSI
KQDDDIKKEFMDDSCGGNNDSSQMDCSTGGGKGKNVNNDGTSMIKMEIKTEDGLDGEVKI
KTEAMDVDEAGGSTAGEHHGEGGGGSGVGGGKDNINGAHDGGATGGAVDIKPKTETKPLV
PEPLAPNAGDKKKKCQFNPEELRTALLPTLEKLYRQEPESVPFRYPVDPQALGIPDYFEI
VKKPMDLGTIRTNIQNGKYSDPWEYVDDVWLMFDNAWLYNRKTSRVYRYCTKLSEVFEAE
IDPVMQALGYCCGRKYTFNPQVLCCYGKQLCTIPRDAKYYSYQNRYTYCQKCFNDIQGDT
VTLGDDPLQSQTQIKKDQFKEMKNDHLELEPFVNCQECGRKQHQICVLWLDSIWPGGFVC
DNCLKKKNSKRKENKFNAKRLPTTKLGVYIETRVNNFLKKKEAGAGEVHIRVVSSSDKCV
EVKPGMRRRFVEQGEMMNEFPYRAKALFAFEEVDGIDVCFFGMHVQEYGSECPAPNTRRV
YIAYLDSVHFFRPRQYRTAVYHEILLGYMDYVKQLGYTMAHIWACPPSEGDDYIFHCHPT
DQKIPKPKRLQEWYKKMLDKGMIERIIQDYKDILKQAMEDKLGSAAELPYFEGDFWPNVL
EESIKELDQEEEEKRKQAEAAEAAAAANLFSIEENEVSGDGKKKGQKKAKKSNKSKAAQR
KNSKKSNEHQSGNDLSTKIYATMEKHKEVFFVIRLHSAQSAASLAPIQDPDPLLTCDLMD
GRDAFLTLARDKHFEFSSLRRAQFSTLSMLYELHNQGQDKFVYTCNHCKTAVETRYHCTV
CDDFDLCIVCKEKVGHQHKMEKLGFDIDDGSALADHKQANPQEARKQSIQRCIQSLAHAC
QCRDANCRLPSCQKMKLVVQHTKNCKRKPNGGCPICKQLIALCCYHAKNCEEQKCPVPFC
PNIKHKLKQQQSQQKFQQQQLLRRRVALMSRTAAPAALQGPAAVSGPTVVSGGVPVVGMS
GVAVSQQVIPGQAGILPPGAGGMSPSTVAVPSPVSGGAGAGGMGGMTSPHPHQPGIGMKP
GGGHSPSPNVLQVVKQVQEEAARQQVSHGGGFGKGVPMAPPVMNRPMGGAGPNQNVVNQL
GGMGVGVGGVGGVGVGGVGGVGVNQLNSGGGNTPGAPISGPGMNVNHLMSMDQWGGGGAG
GGGANPGGGNPQARYANNTGGMRQPTHVMQTNLIPPQQQQQMMGGLGGPNQLGGGQMPVG
GQHGGMGMGMGAPPMAGTVGGVRPSPGAGGGGGSATGGGLNTQQLALIMQKIKNNPTNES
NQHILAILKQNPQIMAAIIKQRQQSQNNAAAGGGAPGPGGALQQQQAGNGPQNPQQQQQQ
QQQQQVMQQQQMQHMMNQQQGGGGPQQMNPNQQQQQQQVNLMQQQQQGGPGGPGSGLPTR
MPNMPNALGMLQSLPPNMSPGVSTQGGMVPNQNWNKMRYMQMSQYPPPYPQRQRGPHMGG
AGPGPGQQQFPGGGGGAGNFNAGGAGGAGGVVGVGGVPGGAGTVPGGDQYSMANAAAASN
MLQQQQGQVGVGVGVGVKPGPGQQQQQMGVGMPPGMQQQQQQQQPLQQQQMMQVAMPNAN
AQNPSAVVGGPNAQVMGPPTPHSLQQQLMQSARSSPPIRSPQPTPSPRSAPSPRAAPSAS
PRAQPSPHHVMSSHSPAPQGPPHDGMHNHGMHHQSPLPGVPQDVGVGVGVGVGVGVNVNV
GNVGVGNAGGALPDASDQLTKFVERL
Download sequence
Identical sequences M9PH39
NP_001259387.1.81976 FBpp0305701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]