SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0305726 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0305726
Domain Number 1 Region: 201-275
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.44e-18
Family PHD domain 0.0043
Further Details:      
 
Weak hits

Sequence:  FBpp0305726
Domain Number - Region: 120-186
Classification Level Classification E-value
Superfamily RING/U-box 0.0184
Family RING finger domain, C3HC4 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0305726   Gene: FBgn0031091   Transcript: FBtr0333546
Sequence length 520
Comment pep:known chromosome:BDGP5:X:20054677:20059863:-1 gene:FBgn0031091 transcript:FBtr0333546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQICVLCLSGERDELIFGTVHVEGNMMVHRNCLYLSSNLIQRGEKKLSIMNFLKEDIEA
EVNRCRLLKCCYCRRLGANIWCCKSGCRRTFHTKCGVDNLAQNQFCDTYNSFCHQHVLVP
RNRPVFKNDEECLLCAEDVVAKGERFSVVTCLYAPCCRNGWFHRRCLQRYANSSGYFFKC
PLCNNTDVFRRVAYMGIAVLDQDASWETEPDAFAGQYRRDVNCTAALCVAVSGRADTSAM
LLYCTSCGANPSHYLCTLKTLQNYVCKVCSAVSPEAVPVAESDSDDAGSMDDSAEAPRPG
HLNGDQIQEKLSPSHWDDFGSSDDDAVFQRAFDTKVQSRVVTLSDDQPSTSAGARALADR
GTRTFESQGTQTTFLSSVVTSFRSATATATSSTSTSTSTSASTLDNQENTEPSTSNGRRP
WRPRYVSPPRHVSDSDDDSDEYDSDEYESKRRQLTPTAAAPSNGRRLLGSISPEPSTPAP
RVLRRRTLANRPSSLANMDISCVANRTRHRLSNHMASRKD
Download sequence
Identical sequences Q9W5W9
FBpp0070026 FBpp0305726 FBpp0305727 7227.FBpp0070026 FBpp0070026 NP_001259740.1.81976 NP_001259741.1.81976 NP_608374.1.81976 FBpp0070026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]