SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0305739 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0305739
Domain Number 1 Region: 64-250,287-447
Classification Level Classification E-value
Superfamily L domain-like 1.08e-43
Family Internalin LRR domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0305739   Gene: FBgn0036587   Transcript: FBtr0333562
Sequence length 574
Comment pep:known chromosome:BDGP5:3L:16258897:16261256:-1 gene:FBgn0036587 transcript:FBtr0333562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRTRRILEVIVILILAISSCDGSGGDIPLRCDEYDSMGYMDVNEAFCTVTGFTVTHSQN
VVIKNIPPGNMVKFMKFYESTLLYMPFHLFETFPYLKTLDVSNTNILELTRNAFSAASNL
TYLNLAYNNLTSIQTSVFIGANVLMRLDLSYNEISSLSVNAFCGLHTISQIYLTGNLLKE
LHNDIFKDNEYLEKVSFEGNLLTSIQPEVFRNMRRIKEVNLSNNRLIFIHPDTFADAASL
ENLVLSYNELKNFQLTEKNIVHQLHLDNNYLTNLTINATRFVRASHNQISELFLHQSLHI
ETLDLSANKLSSISNITNITHMLYLDVSDNPIGPLNISTFSQLKRLRGLNLRGTGIRELK
FGMFSKQKYLEELDLSFNNLTILNLDMFVPYLTNLKKFLIDGNGLTELQGNRTFSEAFPQ
LQKLGVSRNRFNCSYLHHLLIPPSLPESVVLNIEPDTNLDETPHIRDVSCISQSQEVVNA
SFTAEESKLESQIQMLSKQLDIVGSHSKNLELHLAFMQIFAYVMGGLVLVGVVSLITLRY
LKNQRSGRYDRSSIVFRSNATMEANLTLGSEDLQ
Download sequence
Identical sequences Q9VV09
FBpp0288699 FBpp0305739 7227.FBpp0288699 NP_001261934.1.81976 NP_648855.2.81976 FBpp0288699 FBpp0288699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]