SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0305747 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0305747
Domain Number 1 Region: 31-314
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.37e-72
Family FCH domain 0.00000047
Further Details:      
 
Domain Number 2 Region: 537-598
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000302
Family SH3-domain 0.002
Further Details:      
 
Domain Number 3 Region: 365-437
Classification Level Classification E-value
Superfamily HR1 repeat 0.00000523
Family HR1 repeat 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0305747   Gene: FBgn0035533   Transcript: FBtr0333570
Sequence length 602
Comment pep:known chromosome:BDGP5:3L:4322491:4364102:-1 gene:FBgn0035533 transcript:FBtr0333570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLALLASGSSRSSSNNKLAESENSAQNSNNMSWGTELWDQNENLAIHTNRGIDALDKFAN
FLRDRVAIETEYAGKLRRLVKNYQPKKKEEEDNEFTSVQAFRNLLKEVGDLAGQREVVSE
SLQLQIIAGVTLLSKTLREERKKCLSDGATLQQNLTTQLSSLDRAKRNYEKAYRDSEKAV
DSYKRADMDLNLSRAEVERYKNVMTSKIQQSDDAKNEYANQLQKTNNLQQQHYSMLLPSV
LNRLQELDEKRTRGFREFIVGAADVESSVAPIIARCMEGIVKAGESINEKEDTFKVIERY
QSGFTPPRDIPFEDLSKCDPDSVQDSHYSNSTSNHLTIRGTMSANKLKKRVGIFNIFGSN
KEDFSDLPPNQRRKKLQAKIAELTQNIAQETKARDGLMKMKIVYEANSSLGNPMTVEGQL
NESEHKLEKLKVDLKKYQGFLEKASQVPTATSSPQASRNQLQNGHRTSRHSNGSADDHHD
DGDDQPDDAGSLSSSASPESGLGTSHTSLPGSGQGSANENAIGEDTYYETEVETLNPVGK
CRALYPFEASSEGSIPMSEGEELQVIEIDQGDGWTRVRRENNSNGWDEGFVPTSYIEITL
YA
Download sequence
Identical sequences M9PBP3
NP_001261412.1.81976 FBpp0305747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]