SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0305757 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0305757
Domain Number 1 Region: 1004-1314
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.66e-66
Family Tandem AAA-ATPase domain 0.0000663
Further Details:      
 
Domain Number 2 Region: 750-1002
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.82e-60
Family Tandem AAA-ATPase domain 0.0000386
Further Details:      
 
Domain Number 3 Region: 1414-1536
Classification Level Classification E-value
Superfamily Bromodomain 6.41e-30
Family Bromodomain 0.0013
Further Details:      
 
Domain Number 4 Region: 640-718
Classification Level Classification E-value
Superfamily BRK domain-like 3.01e-22
Family BRK domain-like 0.0021
Further Details:      
 
Domain Number 5 Region: 284-359,404-457
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000000000144
Family beta-sandwich domain of Sec23/24 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0305757   Gene: FBgn0000212   Transcript: FBtr0333580
Sequence length 1642
Comment pep:known chromosome:BDGP5:3L:15963182:15975969:-1 gene:FBgn0000212 transcript:FBtr0333580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPSPANSPMPPPQAPSPMAPPSQSPAPSPHSPYPHQQPGPLQGPPPPGHPGAYGHPMQ
HGPPGQGPPGHHMPPHHQGMSPHMGMQMPPTGPNMSPYQTHGMPPNLLCKMEFVAPTQPC
IVSPGGPPGGPPPPERSSQENLHALQRAIDSMEEKGLQEDPRYSQLLAMRATSKHQHLNG
NQVNLLRTQITAYRLLARNKPISMQMQQALQAAQQQPPPGPPIGPPGAPGGPPPGSQHAG
QPPVPPQQQQQPPPSAGTPPQCSTPPASNPYGPPVPGQKMQVAPPPPHMQQGQPLPPQPP
QVGGPPPIQQQQPPQQQQQQSQPPPPEPHQHQLPNGGKPLSMGPSGGQPLIPSSPMQPQV
RGTLPGMPPGSQVPQPGGGPQRQVPPAGMPMPKPNRITTVAKPVGLDPITLLQERENRIA
ARISLRMQELQRLPATMSEDLRLQAAIELRALRVLNFQRQLRMEFVQCTRRDTTLETALN
IKLYKRTKRQGLREARATEKLEKQQKLEAERKRRQKHLEFLAAVLQHGKDLREFHRNNKA
QLARMNKAVMNHHANAEREQKKEQERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAFLLS
QTDEYISNLTQMVKQHKDDQMKKKEEEGKRLIQFKKELLMSGEYIGIDEGSIVADMRVHV
VEQCTGKKLTGDDAPMLKHLHRWLNMHPGWDWIDDEEDSCGSNDDHKPKVEEQPTATEDA
TDKAQATGNDEDAKDLITKAKVEDDEYRTEEQTYYSIAHTIHEKVVEQASIMVNGTLKEY
QIKGLEWLVSLYNNNLNGILADEMGLGKTIQTISLVTYLMDRKKVMGPYLIIVPLSTLPN
WVLEFEKWAPAVGVVSYKGSPQGRRLLQNQMRATKFNVLLTTYEYVIKDKAVLAKIQWKY
MIIDEGHRMKNHHCKLTQVLNTHYIAPYRLLLTGTPLQNKLPELWALLNFLLPSIFKSCS
TFEQWFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVEHQLPDKVEYIIK
CDMSALQRVLYKHMQSKGVLLTDGSEKGKHGKGGAKALMNTIVQLRKLCNHPFMFQHIEE
KYCDHTGGHGVVSGPDLYRVSGKFELLDRILPKLKATNHRVLLFCQMTQCMTIIEDYLGW
RQFGYLRLDGTTKAEDRGELLRKFNAKGSDVFVFLLSTRAGGLGLNLQTADTVVIFDSDW
NPHQDLQAQDRAHRIGQRNEVRVLRLMTVNSVEERILAAARYKLNMDEKVIQAGMFDQKS
TGSERQQFLQTILHQDDNEEEEENEVPDDEMINMMIARSEEEIEIFKRMDAERKKEDEEI
HPGRERLIDESELPDWLTKDDDEVERFHYQYDEDTILGRGSRQRKEVDYTDSLTEKEWLK
AIDDGAEFDEEEEEDDSKRKRRKRKNRKEESDDDSLILKRRRRQNLDKRSKKQMHKIMSA
VIKHNQDGRTLSEPFMKLPSRQRLPDYYEIIKRPVDIKKILQRIEDCKYADLNELEKDFM
QLCQNAQIYNEEASLIYLDSIALQKVFVGARQRITAAADAAAVAAGDNTGEAHGNGGSDN
SDNDDDDGGDDGSDDEEIATTSAAAVKMKLKLNKSLASAPATPTQSSSNVSSGAATTSKK
QTRRKRSQKKYTISDDDDDDMD
Download sequence
Identical sequences M9PFM5
FBpp0305757 NP_001261907.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]