SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0305788 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0305788
Domain Number 1 Region: 238-342
Classification Level Classification E-value
Superfamily Immunoglobulin 7.97e-18
Family I set domains 0.016
Further Details:      
 
Domain Number 2 Region: 44-147
Classification Level Classification E-value
Superfamily Immunoglobulin 1.8e-17
Family I set domains 0.083
Further Details:      
 
Domain Number 3 Region: 152-246
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000513
Family I set domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0305788   Gene: FBgn0085420   Transcript: FBtr0333611
Sequence length 469
Comment pep:known chromosome:BDGP5:3L:5422261:5432903:1 gene:FBgn0085420 transcript:FBtr0333611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFILTVVKLLLIALNIFPSRFTNRRIMFLIYMTNLVTHVMMDEPRFAQPIPNVTVAVGRD
ANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSITYTDNTWLLHVNQAHQDDR
GYYMCQVNTNPMISQVGYLQVVVPPNILDIESTPSSVAVRENQNINMTCRADGFPAPKII
WRREDGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSVSKRIILDVEF
SPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWVYNSVMVLPSKKYKTDYTENSYRAH
MKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPLPSTPSKQVTHTTVESRENNIIP
SSRNDTTKSLQTDVGYAMKNDLYPGSASSSSSGGSSSAASSSSSMQTSALPGGVAGNSLS
SMGSKGSLAIGKSTFYTERPPNEYAASSVAGLLLHRALLFGSGIYLTLL
Download sequence
Identical sequences A8JNC7
NP_001097508.2.81976 NP_001261441.1.81976 FBpp0305788 FBpp0305789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]