SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0305836 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0305836
Domain Number 1 Region: 90-136
Classification Level Classification E-value
Superfamily RING/U-box 1.24e-18
Family RING finger domain, C3HC4 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0305836   Gene: FBgn0052850   Transcript: FBtr0333680
Sequence length 146
Comment pep:known chromosome:BDGP5:4:335549:342011:1 gene:FBgn0052850 transcript:FBtr0333680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNCLKISTSDDISLLRGNDSQISGTQPVYHGEHYQRELYPSTSSSTTLTPSSNNRQLSD
ENQVKIAKRIGLMQYLPIGTYDGSSKKARECVICMAEFCVNEAVRYLPCMHIYHVNCIDD
WLLRSLTCPSCLEPVDAALLTSYEST
Download sequence
Identical sequences L0MLM5
NP_001259053.1.81976 FBpp0305836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]