SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0305898 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0305898
Domain Number 1 Region: 172-204
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000111
Family CCCH zinc finger 0.00028
Further Details:      
 
Domain Number 2 Region: 132-167
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000017
Family CCCH zinc finger 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0305898   Gene: FBgn0011837   Transcript: FBtr0333756
Sequence length 436
Comment pep:known chromosome:BDGP5:X:12553448:12576587:1 gene:FBgn0011837 transcript:FBtr0333756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSADILQKSREQDDSHYFERGDISKYVTMNDHLGDFDCNEVRKEIRMLLAHGANLDQQHQ
QQPHRHHGGLTRTISQPAQLIQQQQQQHQQQQQQQPAVASLVTITENLGNMNLHRKLERT
QSEPLPPQQPMNTSRYKTELCRPFEEAGECKYGEKCQFAHGSHELRNVHRHPKYKTEYCR
TFHSVGFCPYGPRCHFVHNADEARAQQAAQAAKSSTQSQSQSQQSSSQNFSPKSNQSSNQ
SSNSSSSSSSSGGGGGGGNSINNNNGSQFYLPLSPPLSMSTGSDRESPTGSLSLSPTNSL
TSFPFHDALQHGYLASNGAKSNSSASSTSSASGMGLGMSMGIGQGMIIGQGLGMGHHGPA
TPPESPNVPISPVHTPPPYDVVVSGSGAGNNSVGSKQLLQKSVSTPMQQEDTPRLPVFNR
LSSGVEAYQQQSNLGL
Download sequence
Identical sequences B3DN56 P47980
FBpp0073516 FBpp0305898 NP_001259490.1.81976 NP_511141.2.81976 NP_727633.2.81976 FBpp0073516 7227.FBpp0073516 FBpp0073516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]