SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0306061 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0306061
Domain Number 1 Region: 162-427
Classification Level Classification E-value
Superfamily L domain-like 7.48e-61
Family Internalin LRR domain 0.013
Further Details:      
 
Domain Number 2 Region: 363-621
Classification Level Classification E-value
Superfamily L domain-like 1.73e-48
Family Ngr ectodomain-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0306061   Gene: FBgn0038504   Transcript: FBtr0333933
Sequence length 641
Comment pep:known chromosome:BDGP5:3R:13222388:13227176:-1 gene:FBgn0038504 transcript:FBtr0333933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLCSSGATASTTSLSSTGQAERSGGVPGGGAEGGGGSGNSGGGGKTSNGSAEAPTLCFA
GGSGTAGAIAGTEELSNANSPANGAGGATGSTGSGQQPTGSNGHSHLHNENNANMPPETR
PKMVTVKHPESNKPKPTTKKSKPIQADQDVIKALQRCRDEGIKRLDLSKSSITVIPSTVK
ECVHLTELYLYSNKIGQLPPEIGCLVSLRNLALNENSLTSLPESLQNCSQLKVLDLRHNK
LAEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLRENKIRELGSAIGALVNL
TTLDVSHNHLEHLPEDIGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLGMRYNRLSSVP
ATLKNCKSMDEFNVEGNGITQLPDGMLASLSGLTTITLSRNQFASYPTGGPAQFTNVYSI
NLEHNRIDKIPYGIFSRAKGLTKLNMKENMLTALPLDIGTWVNMVELNLATNALQKLPDD
IMNLQNLEILILSNNMLKKIPNTIGNLRKLRILDLEENRIEVLPHEIGLLHELQRLILQT
NQITMLPRSIGHLGNLTHLSVSENNLQFLPEEIGSLESLENLYINQNPGLEKLPFELALC
QNLKYLNIDKCPLSTIPPEIQAGGPSLVLQWLKMHSPYRQM
Download sequence
Identical sequences A0A0B4KHN4 Q9VEK6
FBpp0082888 FBpp0082889 FBpp0306061 7227.FBpp0082889 NP_001262664.1.81976 NP_650620.3.81976 NP_732231.2.81976 FBpp0082888 FBpp0082888 FBpp0082889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]