SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0306074 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0306074
Domain Number - Region: 263-379
Classification Level Classification E-value
Superfamily TPR-like 0.0098
Family Tetratricopeptide repeat (TPR) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0306074   Gene: FBgn0027549   Transcript: FBtr0333949
Sequence length 653
Comment pep:known chromosome:BDGP5:3L:8103468:8106420:1 gene:FBgn0027549 transcript:FBtr0333949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSARMLKKLQGDADKLAPPPDDEDCEELSDNDELEDSDMQRYRKSHLNPFDLLNQAGLSL
SESEFKEDDNETEHPSAALPNATASAAKKKKKKRKKKAKSSGNHISSEDNERQDKYFEKV
DPLLGKVYDAVPRQSAKQLVSAATGTTATKKLLAVELRHLNPQNEMRRTFGKRVVKVETK
RGRQKPTLKSTYMVTAKDSWPALTKNTITMKLLPAPDSPSVSSKSITDNGADVQWFAFEH
SQYYQGVQQMFLSALERIDSEFLITLIKRCPYHVDSLVQLSEVCKMTEDFSLASELLERA
LLLLESSLHINFSLTSGNCRLDYRRQENRSFYIVLFKHAQYLEERACSRTAFEISKLLLS
LQPDTDPLAMILVIDYYALRSKQFEWLVEFYEKYNAARNLNQLPNMAYSYALALHTLYGA
CERSNQALQYALLMFPGVLRPLLDEMSVQTDKRVLASSYFFADVSGNQSPALHQLVCLYV
CRARVVWRQNEVLPWLESNVNIVLDRIESKDPLVNEYKEKRSLRYSGTPPRPILRHVILS
DYKEKVPLAVFVSKEKQAIMTYDPLPPPNSVNCYHRKSSSSSSPTTNTNNSVSMFFQSLL
PSFNINNLAANAQLQEGAAPAAGAGAAAGDANIEVGIEQGAAGVAGEGEEHES
Download sequence
Identical sequences M9PBV6
FBpp0306074 NP_001261557.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]