SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0306184 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0306184
Domain Number 1 Region: 158-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000067
Family EGF-type module 0.012
Further Details:      
 
Domain Number 2 Region: 339-414
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000021
Family Complement control module/SCR domain 0.0037
Further Details:      
 
Domain Number 3 Region: 196-317
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000022
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 48-109
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000236
Family Complement control module/SCR domain 0.0036
Further Details:      
 
Domain Number 5 Region: 124-166
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000724
Family EGF-type module 0.0097
Further Details:      
 
Weak hits

Sequence:  FBpp0306184
Domain Number - Region: 403-458
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000806
Family Complement control module/SCR domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0306184   Gene: FBgn0052373   Transcript: FBtr0334059
Sequence length 486
Comment pep:known chromosome:BDGP5:3L:7749804:7752223:1 gene:FBgn0052373 transcript:FBtr0334059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQNRMSTSVIVLYALMCIAFSTASLNDIPEITPAIDNNLSFQYDDTCWTPPRIKNAKAS
VKLRRNGEHVFLVTYYSCRVNYKLKRAKDNALYCSNGIWLGLKPNCIKIGKGNTHSMKQK
KMRCRIDNGGCAHICNRSTHKCECYEGYTLNSTDLRSCNDIDECKESNGGCSQVCNNLPG
EFICTCNSGFEIDESDEKTCLDIDECADPELSWDCTAGCKNLNGTYKCLPSLVGRVEPTD
GDGFSPGEIVCKSGFKLSDDGSECQDINECDLADIDSDSWRMTYRYCEHKCENTVGSYIC
HCPQGYHLLDDQNSCILDGSKLPPSKDAPVSQEAPRKDICPLFKGPANGKASCDKYLQNG
FNYTRCNITCNAGYIMQGSQFAVCGHTGLWSSPEAKCVESLALSCPVLTPPRNGRFYPAS
CNNEPSKSLAICELLCDRGYLPRMDTQLICAAPWGWIQRRWQDNVPQYVFQQSVKQDEGC
VKIAPP
Download sequence
Identical sequences Q8SYF5
FBpp0076517 FBpp0076518 FBpp0306184 FBpp0076517 FBpp0076518 FBpp0076517 NP_001261534.1.81976 NP_729293.1.81976 NP_996019.1.81976 7227.FBpp0076518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]