SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0306220 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0306220
Domain Number 1 Region: 2-234
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.96e-68
Family IMD domain 0.0000248
Further Details:      
 
Domain Number 2 Region: 364-418
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000866
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0306220   Gene: FBgn0052082   Transcript: FBtr0334096
Sequence length 629
Comment pep:known chromosome:BDGP5:3L:11129149:11157084:1 gene:FBgn0052082 transcript:FBtr0334096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAEEVTKLVDGVYRNILDRFNPGARQLIAAGKSYLKALHGAATASRLFNEALAKIAMNA
QQSGTGDIGSALMSVVNVNKEIQDQQMNILKAFYVDLLVPLETNLEKDTKVVQHEQKKFL
QQHKVRMESYQKAVSTMKKQRKKKATPENTEKELRSLQLLEDQKKKLDVFCDQSYKNAMT
QERRRYGFVLERQCSIAKHWMVYHTTGKTVIDNNFENWQEIAASREIIPPAAYESGYSTS
NGHNNNNISSSSSSGNNNTSGNMRRLERIKDGDDDHLQGHGAQLKKSRSIDAPYGDMRTL
HERENLSGLGGTGPAHYAQNSLPRAKSDFNLALVGTGQSSANKHKIIEEQLATLGDDQRG
DQRPLVKALYAYMPSGENQLSFEEGDRIALVGGKAKGWQFGENLRTQHFGWFPVAYTNAE
VAEVTTSGGRRYENMLMSYERNGGGSGSGSGGGGLRSYQQQQDYEAQLELMESHEATYRR
RRNHSAEDSSPTRMFGDTIKQQKKYRPGSGANPRPGPPPTLPAPVPNGPQSQSSRMLNSS
QSFCASNGGGVNAAVERRKQKLLNGVQSSKNHPSGKSGVAAKTSLHSSNDSGFANEPPPQ
PEVDYSDEEPATQRVAIRRGIYRNYSIDY
Download sequence
Identical sequences A8JNR2
NP_001097583.2.81976 FBpp0306220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]