SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0306229 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0306229
Domain Number 1 Region: 1050-1382
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.61e-65
Family Ankyrin repeat 0.0000358
Further Details:      
 
Domain Number 2 Region: 1404-1512
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000557
Family Tetratricopeptide repeat (TPR) 0.0045
Further Details:      
 
Domain Number 3 Region: 526-578
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000762
Family RecA protein-like (ATPase-domain) 0.091
Further Details:      
 
Weak hits

Sequence:  FBpp0306229
Domain Number - Region: 91-139
Classification Level Classification E-value
Superfamily RING/U-box 0.000132
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number - Region: 551-609,652-704
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00026
Family RecA protein-like (ATPase-domain) 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0306229   Gene: FBgn0041096   Transcript: FBtr0334109
Sequence length 1568
Comment pep:known chromosome:BDGP5:3L:12001325:12049574:-1 gene:FBgn0041096 transcript:FBtr0334109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPLTNRSSSGNRTNNNPSNNNNNQTTSFIIGGTTNINNNNNQLGGTNSAKDKGNFENNW
SCNKTTGRRSGSGNSCSFLDLQSIRRLLEHDASGSVCPSCRISFDKGKRRKLIDTCGHER
CYSCMFRNDQCPMCMNSSLKDVDGANAQGYDTGIGGSTSTIVSPLGSPQPQLRSHAQRNA
ALARYMQHRQESQSPDYHHRYASNGKLPRAAALSTNGNGFTTGTTQTVTVDVHHQLGGGG
GGAAAAAKQLMANGISGHSRSSSMSHNIHAAAYSELSAAPPAFATPPTRRRFFNHKNLRS
ALTGGSGGGSGVGGGVGGAGGVGGGHRRTASNGGCPIDTASILSGGSDAIDHHSSFLNEK
LQKDQLHARLGLLLNDPGSNGNSSSSGSGCEPISAHSTTSTTSSSGVGAASTTTSGSSQN
VSPEQTLASGAGMLSGSQLSVATSHGVKEDALSLCGKFKAGCSMLHVYEALPSKSRKGNV
RRSTRGQQGSSSSASAASAVGSRVTASSLAAVQLALKPLFFEVPLQEPDPPYVGRQWLVQ
QLSNILLGTETRVVLINGQPGTGKTAFCLQLVEYSCFGRRQMQDDPDGIYSQLQLGAHCE
RMRGLASHMVGYHFCQADANLTCQVPDFVHSLAAQLCQAPQLTAYRDYLLSEPHLQDILS
VRECIADAERVMKLAILEPLAHLHRAGKIPAKVAVIVVDALCEAEYHRPDHGHTIASFLA
QLTPHFPAWLKLVATVRTQMLELVKAPSYTQLTLDSWASSQALQQDMLDYIGARLADSPE
IRMNIGGGGGQNSQSGSQPQTKFVSHLQSLSRGSMLYAKLILDLIARGQLVIKSSSYKVL
PVSLAQIFLLHFNLRFPTARSFEQAAPILNICLAALYPLTLDEIYYSMEALSHGREALSW
PDFMQRFKLLDGFLIKRLDNTYMFFHSSLREWLMRRDEGESNKFLCDARLGHAGIAFRLS
RLQAPLSPQLTLELGHHMLKAHLYGGTSLTLLSPRDLQSYWLAGAADNISSSLGALRNVY
SPNLKVSRLVLLAGASPNHRTDYMGGAPILCIAAHEGILPMVSLLLEFGADVGLTNSQGC
TPLILAAMRGHCDVVRPLVAAGSSLGQLDITQRCALVHAARMGHLSVVKYLLACDWSPRP
HSQDVTRSVALQQALIGAAAQAHCKILEDLLDLNETEFDLDVNGMEPSSGELALTAAARH
GCIDVVGILLSRGAQIDARNRQGYSALWLAVKEGHWSVVEHLLQRGALLDEPLGQTRKTP
LMIAAEEGHLELVDLLLARGAQREAQDHEGFTALSWACLRGHLAAAKTLIEHGCNRHHED
HNGRTALDLAAYQGAASLVIYILEQGGNLEHIDVHGMRPLDRAIACRNIQAVQVFLRKGA
KLGPTTWSMAMGKPEILVILLNKLLEDGNVLYRKNRFQEAAHRYQYALRKISGLEQLLER
NAIFAQLRTNLLLNLSRCKRKLNELDASIDLATQAIAQKPHSYEGYYARAKARMELGALN
EALVDANEAMQQAAQSGVLCEVVEVLKRIQTELLTRISISSEDQTGRMSNIGGGASVAYE
SHHEITDL
Download sequence
Identical sequences M9PI28
NP_001261738.1.81976 FBpp0306229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]