SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070443 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070443
Domain Number 1 Region: 36-139
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.66e-37
Family Cold shock DNA-binding domain-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070443   Gene: FBgn0003714   Transcript: FBtr0070459
Sequence length 140
Comment pep:known chromosome:BDGP5:X:2336346:2338009:-1 gene:FBgn0003714 transcript:FBtr0070459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFLRQSFGITKQLASQAIQCSYETAVRGMASLQQMHRSGPHIKTRPPRQPLDGKPFAKG
VVLKTLIKKPKKPNSANRKCVLVRLSTGKEMVAYIPGIGHNLQEHNIVLCRVGRLQDVPG
VKLKAVRGVYDLAHVVKKSQ
Download sequence
Identical sequences A0A1B2AKT7 P10735
FBpp0070443 FBpp0070443 7290321___KOG1750 NP_525050.1.81976 FBpp0070443 7227.FBpp0070443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]