SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070704 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0070704
Domain Number - Region: 32-84
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0262
Family SIAH, seven in absentia homolog 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070704   Gene: FBgn0029724   Transcript: FBtr0070736
Sequence length 301
Comment pep:known chromosome:BDGP5:X:4663138:4664116:-1 gene:FBgn0029724 transcript:FBtr0070736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRNKPLRLIGLSSTEPEKQTKLTLNHLCQLPAQCPIEKCISTVFKDDMLQHLAQRHFRS
NVKKHLQVAFNGERCTLVFDVSQLIGTQTICLGVLLYGGVRGKHSQLPGEREFCYHNRLK
EDSGLESLKDYLPIMVLVKRTTFLCWALVDRKMESQEDLNGKQSKDLKQVKHLDFSNDTH
PKCSEESIKRCDSGQKNNDLKTTTEAEQEEIMDSDILIIWTQSAPCIRPLHVAMTVFNST
LSVGRSAMRCVANSGQMYTEIGGKDLPKDRHSLLITQQELKEICGAEHHLHLELILHEPL
E
Download sequence
Identical sequences Q9W4H1
FBpp0070704 7227.FBpp0070704 NP_572184.1.81976 FBpp0070704 FBpp0070704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]