SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070907 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070907
Domain Number 1 Region: 252-284,323-426,477-526
Classification Level Classification E-value
Superfamily TPR-like 2.05e-22
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 
Domain Number 2 Region: 65-132,161-200,255-297
Classification Level Classification E-value
Superfamily TPR-like 0.00000348
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070907   Gene: FBgn0029879   Transcript: FBtr0070946
Sequence length 615
Comment pep:known chromosome:BDGP5:X:6491078:6493732:1 gene:FBgn0029879 transcript:FBtr0070946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASFLIVVEKMEIALFANAKKLYDHKLYECVIPAADLLRTVLKNDRYVATLDVEYQVLLY
LLNANYKERNYRAALRHFDEIIHKRRLMMRHKNAVLVAIESSYPEFGDAEQRRRAAECYR
QIGNTDMAIETLLQVPPTLRSPRINLMLARLQHHGSRHGTTKKSEAVLAYKEVIRECPMA
LQVIEALLELGVNGNEINSLVMHAATVPDHFDWLSKWIKALAQMFNFKHSDASQTFLMLH
DNTTLRCNEHLMMALGKCLYYNGDYFQAEDIFSSTLCANPDNVEAIGLMAVLCGQEGGCE
QDSADMDYLFAKVSSEVKYTASHWFAHAQLLYDEGKFERGLNFVEKCLDSEPRNHEALIL
RGRLLIALERHTQAVCAFRTAQMVAPYRFEIYRGLFHSYLAQKRFKEANALCNWTIRLFQ
NSPRSFTMFGRTLFLFPDPRMRRTARKFAEKSLKINHIYTPAVNLIADICQVEGPTKAII
KLLEKHVIIFPKVNLLNHLGDIMRKQKEPVKAMEYYYKALRQDPKSKRTLRGLRLLAKSD
DESPVLDESDDIGMDNQQSINDLTTLCEATNAQGAEGAESVENSREASSSAAARSGQEED
VDEHDWIDVPDGMSY
Download sequence
Identical sequences Q9W3Y6
FBpp0070907 FBpp0070908 NP_572329.3.81976 7227.FBpp0070907 FBpp0070907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]