SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071073 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071073
Domain Number 1 Region: 15-147
Classification Level Classification E-value
Superfamily Bromodomain 5.49e-43
Family Bromodomain 0.00019
Further Details:      
 
Domain Number 2 Region: 475-589
Classification Level Classification E-value
Superfamily Bromodomain 1.07e-39
Family Bromodomain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071073   Gene: FBgn0004656   Transcript: FBtr0071118
Sequence length 1110
Comment pep:known chromosome:BDGP5:X:7942563:7955469:-1 gene:FBgn0004656 transcript:FBtr0071118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSEPPPRYEPPVEPVNGIVQPPVIPPAERPGRNTNQLQYLIKTVMKVIWKHHFSWPFQ
QPVDAKKLNLPDYHKIIKQPMDMGTIKKRLENNYYWSAKETIQDFNTMFNNCYVYNKPGE
DVVVMAQTLEKVFLQKIESMPKEELELEPVTAKGGKKKQRAPATPKSSSGGAGASTGSGT
SSAAVTSGPGSGSTKVSVAASSAQQSGLQGATGAGGGSSSTPGTQPGSGAGGAIAARPVS
AMGGTVSSTAGGAPSIPPISTMPPHTVPGSTNTTTTAMAGGVGGPGAAGANPNAAALMAS
LLNAGQTGAYPGAPGQTAVNSSSLLDGSTAAVAAAAAAAAAAAAAAGGAAGAAGGAGTIP
AVAVNAANAVQAYVNAGVSVGVDAVIPPQQPAKIKKGVKRKADTTTPTANAFESPYTQMD
SKSAKIATRRESNRQDLTFQGSGYNMSPLGVSGVPGLGGLVAGGVAGVAVAKNKEKLSDA
LKSCNEILKELFSKKHSGYAWPFYKPVDAEMLGLHDYHDIIKKPMDLGTVKRKMDNREYK
SAPEFAADVRLIFTNCYKYNPPDHDVVAMGRKLQDVFEMRYANIPDEPVANAAHHHGHGH
GHGHGHGHGHGHGHGHGHGHGYGGSSSLKHDASDSSSEDSSDTENESNSDEERSARLKML
ESKLLGLQEEIRKLSEEASAKKKAKKKLKEKKKSIGGGSGSGSASHHCHATGGGANAGGA
GGPGSGGHGSVSVPGGVGSLGPGGAGGANLNALLGGSLVGHGGAAVAGGVPNVGALHSQV
HDVAMAFSQMAGGGAAAGAGFGAGVTAAGASSGGKAGTLAGALAAGAAAGAGGTTAGSGS
SKGAKSKGGRGAKGSGAGGVGASNNAAAGNAAGGAAGAAAGAGSVGGVGGAGAAGGGNAS
KRAKGSSSAGAGGGVGGANASAGGAGARGSSKKKPSQVMNFDSEEEDTAKPMSYDEKRQL
SLDINKLPGDKLGRVVHIIQNREPSLRDSNPDEIEIDFETLKPSTLRELESYVASCLRKK
TRKPYYKKPSGKSKDEQMAEKKQELEKRLQDVTGQLGASKKTAKKDESASSKVEAVQPAN
PVSSSSSSSDSSSSSSSDSSSSDSSDSEAG
Download sequence
Identical sequences E1JJJ8
FBpp0071073 FBpp0089297 FBpp0089298 FBpp0089299 FBpp0290524 FBpp0071073 FBpp0089297 FBpp0089298 FBpp0089299 FBpp0290524 NP_001162699.1.81976 NP_727228.1.81976 NP_996368.1.81976 NP_996369.1.81976 NP_996370.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]