SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0072081 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0072081
Domain Number 1 Region: 14-92
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 4.61e-29
Family eIF5a N-terminal domain-like 0.00029
Further Details:      
 
Domain Number 2 Region: 85-153
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.28e-22
Family Cold shock DNA-binding domain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0072081   Gene: FBgn0034967   Transcript: FBtr0072172
Sequence length 159
Comment pep:known chromosome:BDGP5:2R:19945347:19947002:1 gene:FBgn0034967 transcript:FBtr0072172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELDDQFETTDSGASTTYPMQCSALRKNGFVMLKSRPCKIVEMSTSKTGKHGHAKVHMV
GIDIFSNKKYEDICPSTHNMDVPNVKREDLQLIAISDDSFLTLMTESGDLREDLKVPEGE
LGEQLRLDFDSGKDLLCTVLKACGEECVIAIKTNTALDK
Download sequence
Identical sequences A0A1B2AK02 Q9GU68
7227.FBpp0072081 7291729___KOG3271 NP_611878.1.81976 NP_726411.1.81976 FBpp0072081 FBpp0072081 FBpp0072082 FBpp0072081 FBpp0072082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]