SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0072184 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0072184
Domain Number 1 Region: 5-106
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.13e-23
Family Cold shock DNA-binding domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0072184   Gene: FBgn0034986   Transcript: FBtr0072277
Sequence length 155
Comment pep:known chromosome:BDGP5:2R:20061187:20061958:-1 gene:FBgn0034986 transcript:FBtr0072277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRGLLLMGQCMPCIKQNASKIRIRRMELDKNLNMYFKKDEFYFAHDPQKVCKTGDVVL
IRELPERLTRLITHNVEKVVYPLGDITDPLTGKKVVVGNYREDIEMANQLFGKSEKAFDY
EKAPPRGRLEGTKDFTHGETYIKYHEDGKDQPFAV
Download sequence
Identical sequences Q9W199
FBpp0072184 FR614 FBpp0072184 7227.FBpp0072184 FBpp0072184 NP_525119.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]