SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0072709 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0072709
Domain Number 1 Region: 196-257
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000048
Family RING finger domain, C3HC4 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0072709   Gene: FBgn0035232   Transcript: FBtr0072829
Sequence length 708
Comment pep:known chromosome:BDGP5:3L:1555363:1558484:-1 gene:FBgn0035232 transcript:FBtr0072829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSNNSSNSKKQPQSSHHGKSSSAESQRKSSELHTNSNKQRHSRRRNQVPTPRNDQQQQP
QQPAKLRPNVDKRPKARGFGGGYDFPSPRGQDGASGSSRLAYSATGYSRSGDFDHELNSV
YTQGSKKQNLNHLLNFHCVPRELERGHHHQAQQHHGLSGRKQRYNKEQFLQANFQFVIRS
GAKAQVNGSPDALIDWSYIEQINIQTTEELQCPICLYPPVAAKLTRCGHAYCWPCLLHYL
SLSDKTWRKCPICYDAIHAGDLKSCTIEQLRDLQVGEKITFQLMRRRKGSMYIENHVAGL
GETIERFPFVSAGEEAKRYSKFLIAKRMDVAAIIERERNELLAESDVSCPEDVFIQQALV
MLQERVEKLGVEKPDPKEDEEETAPVLCLETETKIDIEKSDDASISSGEASSSLSYSSNH
NKYYYFYQSNDGQNIYLHPLNVKMLQACYGTLDLGPLLIEAQIVQMEQHSMDEEHRRKFT
CLGHLPLTCQFSVVEVELQPPVVTGGILKLFKEDILHRKKERQRRDREERKREQHINEIN
DRQMGKLIASAANLDLSSSHEFPTCGFEEALPAPSGSVPMNISNQDPGSRYSSVTLGSPK
QEMWPTIGSNSPGGGGAPLDVQVGAWGRSAPPPPRAVMVPRTSDEDFEQRSVGHWGLGEL
LVGALDQKKQKVGAAKSNGAAPAESKKQKKAKGKKMVPLFATGMNRAP
Download sequence
Identical sequences Q9W0D8
FBpp0072708 FBpp0072709 7227.FBpp0072708 FBpp0072708 NP_647623.1.81976 NP_728629.1.81976 FBpp0072708 FBpp0072709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]