SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073380 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073380
Domain Number 1 Region: 6-111
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.43e-24
Family Single strand DNA-binding domain, SSB 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073380   Gene: FBgn0030322   Transcript: FBtr0073535
Sequence length 112
Comment pep:known chromosome:BDGP5:X:11509262:11509873:-1 gene:FBgn0030322 transcript:FBtr0073535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAFDPRSIINGGMLKQFSGQTVSIMVRVESVAGSTLLASSTDNHKLKINLPGELGAAEG
AWVEVIGVPHGADTLRAKEVIEFGGENIDFDKDGYNGLSHLINNVKAFYRSG
Download sequence
Identical sequences B4IK43 B4R356 Q9VYW3
7227.FBpp0073380 FBpp0073380 FBpp0194534 FBpp0073380 FBpp0214384 NP_001285131.1.81976 NP_572737.1.81976 XP_002044103.1.34323 XP_002106696.1.80810 FBpp0073380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]