SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073753 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073753
Domain Number 1 Region: 155-220
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000353
Family RING finger domain, C3HC4 0.021
Further Details:      
 
Domain Number 2 Region: 4-29
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000706
Family CCCH zinc finger 0.0049
Further Details:      
 
Weak hits

Sequence:  FBpp0073753
Domain Number - Region: 247-270
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0103
Family CCCH zinc finger 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073753   Gene: FBgn0030578   Transcript: FBtr0073936
Sequence length 285
Comment pep:known chromosome:BDGP5:X:14670807:14672016:1 gene:FBgn0030578 transcript:FBtr0073936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYRRSQTICRFHLLGICRFGDLCRFSHDETTPNDNQSPQISEIADEVVENEQVVASTSS
YSRQMTWANAPEFVPRYKANSADFQATEGVQDICPYGGSCIWGSKCSYPLHMEICKMCDL
YCLHPMDQNQRRAHNRECLEQHEQAMELSFAIARSKDKMCGICFDTVVEKKGRERRFGIL
SKCKHIFCLTCIRTWRQAHQFEATVTRGCPECRVFSEFVCPSAYWVDTKEEKDKLLSEYR
AAMGAKDCKYFNGGLGKCPFGNKCFYRHHRRCDDNQTQSNAVNSD
Download sequence
Identical sequences Q9VY20
FBpp0073753 NP_572970.1.81976 7227.FBpp0073753 FBpp0073753 FBpp0073753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]