SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073827 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073827
Domain Number 1 Region: 538-901
Classification Level Classification E-value
Superfamily Arginase/deacetylase 6.71e-113
Family Histone deacetylase, HDAC 0.000000573
Further Details:      
 
Domain Number 2 Region: 110-468
Classification Level Classification E-value
Superfamily Arginase/deacetylase 9.59e-105
Family Histone deacetylase, HDAC 0.00000202
Further Details:      
 
Domain Number 3 Region: 990-1086
Classification Level Classification E-value
Superfamily RING/U-box 6.22e-26
Family Zf-UBP 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073827   Gene: FBgn0026428   Transcript: FBtr0074010
Sequence length 1135
Comment pep:known chromosome:BDGP5:X:15228589:15234393:1 gene:FBgn0026428 transcript:FBtr0074010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRDIWIQSPPIVTRRSAQQAKIQTRAMASKSKTGTTGAATAAGGTGSSSGSISGGFNAA
DPRKSNKPNAALLEAKRRARNNMLKNQGCGSQESVTDIFQNAVNSKSLVRKPTALIYDES
MSQHCCLWDKEHYECPERFTRVLERCRELNLTERCLELPSRSATKDEILRLHTEEHFERL
KETSGIRDDERMEELSSRYDSIYIHPSTFELSLLASGSTIELVDHLVAGKAQNGMAIIRP
PGHHAMKAEYNGYCFFNNVALATQHALDVHKLQRILIIDYDVHHGQGTQRFFYNDPRVVY
FSIHRFEHGSFWPHLHESDYHAIGSGAGTGYNFNVPLNATGMTNGDYLAIFQQLLLPVAL
EFQPELIIVSAGYDAALGCPEGEMEVTPACYPHLLNPLLRLADARVAVVLEGGYCLDSLA
EGAALTLRSLLGDPCPPLVETVPLPRAELAQALLSCIAVHRPHWRCLQLQQTYDCVELQD
RDKEEDLHTVLRHWIGGPPPMDRYPTRDTAIPLPPEKLTSNAARLQVLRAETKLSVPSFK
VCYAYDAQMLLHCNLNDTGHPEQPSRIQHIHKMHDDYGLLKQMKQLSPRAATTDEVCLAH
TRAHVNTVRRLLGREPKELHDAAGIYNSVYLHPRTFDCATLAAGLVLQAVDSVLRGESRS
GICNVRPPGHHAEQDHPHGFCIFNNVAIAAQYAIRDFGLERVLIVDWDVHHGNGTQHIFE
SNPKVLYISLHRYEHGSFFPKGPDGNFDVVGKGAGRGFNVNIPWNKKGMGDLEYALAFQQ
LIMPIAYEFNPQLVLVSAGFDAAIGDPLGGCKVTAEGYGMLTHWLSALASGRIIVCLEGG
YNVNSISYAMTMCTKTLLGDPVPTPQLGATALQKPPTVAFQSCVESLQQCLQVQRNHWRS
LEFVGRRLPRDPVVGENNNEDFLTASLRHLNISNDDATAAAGGLAGDRPDCGDERPSGSK
PKVKVKTLSDYLAENKEALEQSEMFAVYPLKTCPHLRLLRPEEAPRSLDSGAECSVCGST
GENWVCLSCRHVACGRYVNAHMEQHSVEEQHPLAMSTADLSVWCYACSAYVDHPRLYAYL
NPLHEDKFQEPMAWTHGCAWREDGCYATGPDGRDEDDDDDNGAGSSICLRLERNN
Download sequence
Identical sequences Q8IR38
NP_727842.1.81976 FBpp0073827 FBpp0073827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]