SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0074243 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0074243
Domain Number 1 Region: 214-284
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000683
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0074243   Gene: FBgn0030873   Transcript: FBtr0074469
Sequence length 321
Comment pep:known chromosome:BDGP5:X:17742143:17744378:-1 gene:FBgn0030873 transcript:FBtr0074469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHQEHMDLHEPVDLNKSLDEMTPEERMRAQHQLMVEKHRGHDAMHSEMVIILFVTLVIAQ
IILVEWKKRHYRSYAFVTLLAMWLIPLIISCSFGWLRFIIIWLVFTCITALVMRRAISKP
IQGTTPRLVYKWFYFIYKLSYGLGLVGYLVIIAAFLGMNYMFSQPPNTWMDVGLMFCFYG
LYIGVLGRDISEICSDKMAAAIGYYTPQGIPTRHLDQNVCAVCGNQLLVSEKEEGVIENT
YKLSCNHVFHEFCIRGWCIVGKKQTCPYCKEKVDLQKMFRNPWEKPHVLYGRLLDWIRWL
VAWQPLIFFIVQGINWMLGLE
Download sequence
Identical sequences Q9VX13
7227.FBpp0074242 FBpp0074243 FBpp0074242 FBpp0074243 FBpp0074244 NP_573247.2.81976 NP_728098.1.81976 NP_728099.1.81976 FBpp0074242 FBpp0074243 FBpp0074244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]