SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0074721 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0074721
Domain Number 1 Region: 168-476
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 2.78e-39
Family NodB-like polysaccharide deacetylase 0.014
Further Details:      
 
Domain Number 2 Region: 65-107
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000123
Family Tachycitin 0.015
Further Details:      
 
Domain Number 3 Region: 122-159
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0074721   Gene: FBgn0260653   Transcript: FBtr0074953
Sequence length 541
Comment pep:known chromosome:BDGP5:3L:19694077:19701115:-1 gene:FBgn0260653 transcript:FBtr0074953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKLFVVFAVLALAAFNEASASDPLLRYKRQATTEETKKEESFEKELCKDKDAGEWFRLV
AGEGDNCRDVIQCTSSGLQAIRCPAGLYFDIEKQTCDWKESVKNCKSKNKERRVKPLLHT
DEPLCQDGFLACGDGNCIERGLFCNGEKDCSDGSDENTCDIDNDPNRAPPCDPAVCVLPD
CFCSEDGTSIPGDLPAKDVPMMITITFDDAINNNNIELYKEIFKDRKNPNGCSIKATYFV
SHKYTNYSAVQETARKGHEIAVHSITHNDEERFWSNATVDDWAKEMAGMRIITEKFANIT
DNSVVGVRAPYLRVGGNNQFTMMEEQAFLYDSTITAPLSNPPLWPYTMYFRMPHRCHGNL
QSCPTRSHAVWEMVMNELDRREDPVNDEYLPGCAMVDSCSNILTGDQFYNFLNHNFDRHY
DQNRAPLGLYFHAAWLKNNPEFLDAFLYWIDEILANHNDVYFVTMTQVIQWMQNPRTISE
VKNFEPWREKCVVEGKPACWVPNTCKLTSKEVPGETINLQTCVRCPNNYPWVSDPTGDGF
F
Download sequence
Identical sequences Q9VW34
FBpp0074721 NP_001262062.1.81976 NP_730444.1.81976 7227.FBpp0074721 FBpp0074721 FBpp0305995 FBpp0074721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]