SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0075526 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075526
Domain Number 1 Region: 98-187
Classification Level Classification E-value
Superfamily BRCT domain 6.8e-17
Family DNA ligase 0.038
Further Details:      
 
Domain Number 2 Region: 1909-1981
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000034
Family BRCT domain 0.075
Further Details:      
 
Domain Number 3 Region: 1811-1894
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000000366
Family DNA-repair protein XRCC1 0.028
Further Details:      
 
Domain Number 4 Region: 2085-2161
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000000432
Family DNA topoisomerase II binding protein 1, TopBP1 0.059
Further Details:      
 
Domain Number 5 Region: 8-93
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000563
Family DNA topoisomerase II binding protein 1, TopBP1 0.054
Further Details:      
 
Domain Number 6 Region: 2168-2269
Classification Level Classification E-value
Superfamily BRCT domain 0.00000497
Family DNA-repair protein XRCC1 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075526   Gene: FBgn0052133   Transcript: FBtr0075784
Sequence length 2294
Comment pep:known chromosome:BDGP5:3L:14013415:14022221:-1 gene:FBgn0052133 transcript:FBtr0075784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENLKISDKLFEDVIYFVLGNLDEEIERFLKSGGAQSKLFLSDQITHMICATNYNEEELS
MNLDLYSAIPVTEQWIVHSAKLGRMASTRAFDPSPNQMRLMRGIRVAITNVVAGDRRRLY
AMLTYHGAVVTHSFGATNTHLVCGAANGGIYNKALALPKNAIIIVTPDWVTDSLKYKNCM
PVETYHPRLLKPIEKQRTQKQQATQQQQIQQQQQLQHQHQMQQQQQQQQQQQQQQQQQQQ
QQQQQQQQQQQQQQQQHQQQIIQQQATATSALSDILGFGEDSVAAKSIASIKSQLQASAE
QIQQQQLPVPAQQQVVFVRPQPQPQQPAQQSPHQLQQGGPQAPTPAPHPQHQQQLIIQQQ
KIIPANLQQQPQNQQQIKNILQQRQMKTTQQSQQQQQIQMQLMQQEQQPHPQPLQQQLAQ
QHPQQIAQQLPQQLSQQHPQQIPQQQQSPRLPTTPTGRQTPRTPSTTPQPVQSPQHHQQI
VQQQQVVQQQVGQQQTMVQQQQIVQQQQIVQQQVVQQQQPQQQSVPVSPQIIHQHLMRQQ
QILNQNQMQLQQIVQSGQALTPQQQQQQRQIQQQLQQVMQQQQQLQMQMQQQQQQQNLQQ
QQSPRMVQNRSPVMPPSTPSPSLQQQQHHATSNMLPPQSPRQLQSPAPQMTPPPPPSPQN
AQQQHLRQQQQMQQNRQQHMMGSPQQPQPQSMMSPQQQQQMQPFQQPVHQQQRMQLQQQQ
QLAQQQQQQQQQSPQHISPQSPQISQTPPMQAKLHQHQVVPGQATQPQQSFSQQKPIDPT
DPVQVAQVLSRSALSSNQDSLIMRQQQLKQQQQMQQQQQMAPQPQQQQMAQQPQQQQQQQ
PQQQHTPSPRQSPLQQQPTTPTLQQQPNQQNAQQIQQQQQQQQQQQQQQQQQQQQQQVLT
QQQPQPGQQQQVITQRHVINTSTAQGQQIIQSHMSLALQKQQQLLHVQQQAQQQPQQQQQ
ITQVQQLPPAQQQQQLPQQHQVQQQQPQQVQFTQQQQIALGAGGQVRIIQQTIQRPPTNV
QQQQQVPQQQQQQIIGQFPQQQQLQQQPQQQISGVQQPQQQQQQQKTFIISQQHFNQLSV
QQQQQILAQNPQSQNVYVVNQTQQQLVQQQQMLQQQQIIPQQQQQQRMQMQQQPQQIVVN
QQILSDPQRLQYLQQQQLMQKQQQQQQQQQQQQQQQQQQQQQQLVGQQQQQILIQQQQTP
QQQQILQQKLSNDNQQQQIMQLITQQQLPQRTPPPQQQQQQQLLLQQQQQSPQHHPQMQQ
QHWSPQSPAGGQMASSTPGTPTSVGMQSPLPGGPTTPQPQPQQQFVPRGLRPQTSWPGQP
QQQQPQPTQQQQQIVLPPPQQQQPQQQQQHLGQQQQLVMQQPQQQKIVVDEKTHAHLMSL
DAHKRAEYITKLNQQNKPRVMLRQQVAYQPRPGAPGSIVATRPAGPVPPGHIIVQHQMPP
GLTQQQQVLWLQQQQGKRQVVVRAGTPGLSPIQQQPGAGPQQQQQSPQQQPFNPNDPNQQ
MLMQRQQLRVQQIPIQQQGPQQLGKQTVQLITGPNGQLIEQQTIVQQPQQQSAPGTPTTP
GAGGVLPGNANIMTQTLVMTSTTPDGQPQQSPQQMNLKTKTALANMLSNRLGNNGAQTPQ
QQIIQLPDGQQPQQQQIVQQVVVTGAIQQQQQQLLLQQQQQQQQQQQMVVQQQLPPQQHV
EPPSAAGALRMMGQQHNATAGVPGPPRTQQELLMLQQQQQQQLLQQQQMRRVVALPQQQQ
APQQHLVQQQIVVAPTQSPQQQQQMAVGVGVGVPVQRTPHGYIQTRPGQQPIPMPQFYGH
NPNLKLPADLFLVGCTFYIVEYDETDGDELPIWLDTIRQFGGDIERVYCPRVTHVICRTQ
RHGVVMQALRDAKRCVTAYWLSDICLKRQLMPPWQPLHLPFPSQFGYRKPLERYIITSEG
FEGEEVVRLQQMAEECGAIYTSYLSKVNTVVVCKQLEGNKFNAAKEWNIPMVNALWLSDV
CIGNLSGLSQYENPKYQQYNLVAPFRIECNLVAHLLTAWKAPINLTQEAHERVKRHLSDP
YGNEQKLKRQKMNAFQQEQLPEQIVCVEYPTTTKPPKVIFSQVADAEALKKAVLILGGIV
VDSPADATHLVMTRESRTCKLIQACCHVDYVLKSSWIADSAKAGKFVPTDPYRIQHIPVD
ENLQFNLNTVLCAPTRSTLFAGKYFHVTPDVFPAREEIIRMIESSGGKVEPKRRSGASVA
ETHMQAPDSYIIVTCPTDMHLCADLTRHGNPKCHIVSTEFVMSSILRQQLEIEPNLIPYL
YNNNNVNSCNSNKS
Download sequence
Identical sequences Q9VUB7
NP_729947.2.81976 7227.FBpp0075526 FBpp0075526 FBpp0075526 FBpp0075526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]