SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0075692 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0075692
Domain Number - Region: 40-103
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00223
Family Single strand DNA-binding domain, SSB 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075692   Gene: FBgn0262524   Transcript: FBtr0075960
Sequence length 214
Comment pep:known chromosome:BDGP5:3L:12517087:12518250:1 gene:FBgn0262524 transcript:FBtr0075960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFNQSFEDIESQLDNFVIRKNQQSEKSTGKCGPEVHDNVPLTISQIERATQDPENENVF
ITDDVHPIHFCTCIIYAFVTGNGTHNESFMKFMIDDGTGSLEASITKKPFNGRVISSLYS
EASSLASSEAYKSIAVSMMRLLQVSMEYIDPTRISRGHSLFLRGRPNRFRGKMGLDAFQF
FIDSGRSRNMEIGFVDYLTDWQRRHKTMQNTTNK
Download sequence
Identical sequences Q9VTZ2
FBpp0075692 FBpp0304177 FBpp0075692 7227.FBpp0075692 FBpp0075692 NP_001261777.1.81976 NP_648587.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]