SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0076315 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0076315
Domain Number - Region: 26-148
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0147
Family Growth factor receptor domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0076315   Gene: FBgn0052023   Transcript: FBtr0076588
Sequence length 160
Comment pep:known chromosome:BDGP5:3L:8796702:8797282:-1 gene:FBgn0052023 transcript:FBtr0076588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQYTQLLRVLCSIVIISYMAVHVLGDIKCNVCQPNHVKCLNETHFSFCLDAVSSDQVIQC
PDGQVCTSLLKICLPKGSTPASCTPDAEISCPPCSGAGLFVCTSRTTFQMCDEGKLIGQV
TKCKDNTFCSMKSKKFCVDQCEITKSQNGFECDRESPLDV
Download sequence
Identical sequences Q4V6M5
FBpp0076315 7227.FBpp0076315 NP_729415.2.81976 FBpp0076315 FBpp0076315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]