SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077054 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077054
Domain Number 1 Region: 98-397
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.25e-29
Family NodB-like polysaccharide deacetylase 0.017
Further Details:      
 
Domain Number 2 Region: 28-89
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 7.32e-16
Family Tachycitin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077054   Gene: FBgn0052499   Transcript: FBtr0077362
Sequence length 486
Comment pep:known chromosome:BDGP5:X:21985466:22034545:-1 gene:FBgn0052499 transcript:FBtr0077362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRQCLVGVLLVITGANGQGKEKEEFQCPSHIANGNYADPATCRRFYQCVDGYPYLNRCP
SGLFFDDVQKFCTFKDEAKCGPLPTTPAPATEAPADTAQRCNTENCALPYCFCSKDGTQI
PGDLEPEKIPQIIMLTFDGAVNLNNYQHYQKIFDGKRKNPNGCLIRGTFFMSHEYSNYQQ
IQHLGYYGHEIGTESISQQQGLQDKGYEEWVGEMIGMREILRHFANVSVNDVVGMRAPFL
KPGRNTQYKVLEDFGYIYDSSITVPPVPVPVWPYTLDYKISHECKSGTCPSRTFPGVWEV
PLNTHYVEGYEGGHCPYLDQCVLHNLDEEEVFQWLQEDFSRYYEQNKAPYMMPFHTNWFQ
TKPLENGLHKFLDWALELPDVYILTVTQMLQYVTDPKELRDVSQIESWKCDKSVSVAPKP
CNIWQTCALPFKIPEQNLTDTRYMETCRECPNVYPWLGDAGGTGIAGRDNYIFAGGENPE
EEDSAK
Download sequence
Identical sequences Q9VR69
FBpp0077054 FBpp0077054 FBpp0077054 7227.FBpp0077054 NP_728468.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]