SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077074 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077074
Domain Number 1 Region: 235-306
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000502
Family Canonical RBD 0.046
Further Details:      
 
Domain Number 2 Region: 165-192
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000576
Family CCCH zinc finger 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077074   Gene: FBgn0031628   Transcript: FBtr0077382
Sequence length 314
Comment pep:known chromosome:BDGP5:2L:4794549:4796576:1 gene:FBgn0031628 transcript:FBtr0077382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGRKARRKLIKKQQRKRRRQKHAKERDKLEEEAENQRLMQPEYQKWSQEQEEMQEFQRL
ADERERQLAEESWLRREATAQRQFQMDEAKKRQEQEEVERLQREQAKERAEREERQRKQR
EEETRKAAKAAAEFDAMMESMDEYLNNPRIEKPPSHLLRVMETHPEERACEFFSRTNCCR
YGHACTFNHRRPMLGRILLIRHFFNHSMLQKRCTHKEYASAEEHLELTEQDLRHDYDEFF
NDVVEELRKFGTIVNFRTVRNTLEHLRGHVFVEYTNERSALRAFTNLQGRYYASKRLNVE
FSNLRTWRGAVCGT
Download sequence
Identical sequences Q86BN2
FBpp0077074 FBpp0077074 NP_787976.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]