SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077203 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077203
Domain Number 1 Region: 3-152
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.33e-32
Family Cold shock DNA-binding domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077203   Gene: FBgn0051957   Transcript: FBtr0077514
Sequence length 159
Comment pep:known chromosome:BDGP5:2L:3871480:3872458:-1 gene:FBgn0051957 transcript:FBtr0077514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRSHPSISRRKHLMKEMMEDDYALPTETQQIARVISSRGNNLHEVETVDETFLVSMPNK
FRKSMWVKRGDFLLVEPIEEGDKVKAEICKILTPEHIKEYTKAAIWPDKFTKKPVQEEAT
SQNKDDSDFEDDLLPNTNRPVNRDSSDEEEDEETSSEED
Download sequence
Identical sequences M9PEE8 Q8IQ13
FBpp0077203 FBpp0077203 7227.FBpp0077203 NP_001260011.1.81976 NP_722949.1.81976 FBpp0077203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]