SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077259 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077259
Domain Number 1 Region: 20-96
Classification Level Classification E-value
Superfamily RING/U-box 0.0000165
Family RING finger domain, C3HC4 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077259   Gene: FBgn0005616   Transcript: FBtr0077570
Sequence length 773
Comment pep:known chromosome:BDGP5:2L:3462213:3466111:-1 gene:FBgn0005616 transcript:FBtr0077570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQTAYLKVTRIAMRSASNLSKRRVEELNSGLGELRQLLSCVVCCQLLVDPYSPKGKRCQ
HNVCRLCLRGKKHLFPSCTQCEGCSDFKTYEENRMMAAQLLCYKTLCVHLLHSALFGELA
GMRPQVARELVPRIKLPPKTTQEFIREGSNISDTFDIFLPQPDLPFLKDMPTSLPAETPP
TSAVTTPELPYDHHLNISDIEAEAAATAEQGHFSPLPLLPTGSRMGMLSHAGQIVIATES
SESGFMDQAWTDQVDLSGTVSVSKYTNSGNNFAVSYVMPTSATTKFDPQELQIGQVVQMA
DSTQLAVLAAVEETVETSTQLTVLSTTVEETVETSTQLEVLTSAEEPNEISDQLANLQVE
ESDEALVEETVEEAEGTSIPSEVVAEHMEEDQHLDVHTSQSPTQTEMEEAVEEHVATKTQ
LGHVQTELQDAESLQKDFEDAKAAAEEAKEKEKDLHAISAELQKEDSDEPTLKRKRTRTL
KASQAAKIEPVPSEVKTKVQSGKGALRRIRGKDKEEKVKPPKPKCRCGISGSSNTLTTCR
NSRCPCYKSYNSCAGCHCVCCKNPHKEDYVESDEDDDLEDFEMPKDVPEPMTQSEEPVVA
EPRQEENSMAPPDSSAPISLVPLNNLQQSQHPLVLVQNEKGEYQGFNIFQGSKPLDPVTV
GFTIRVQLQHTDGFGSLPQYAYIMPTIDPPNPPAPSLSPPPPPAPDREVIEPPAKKFRTS
RTRRGRANFSALDTVDELVSGGSRSNSAAGDRSSATDNAHSLFEEIMSGSDDL
Download sequence
Identical sequences A4V038 P50534
7227.FBpp0077259 FBpp0077259 FBpp0077260 FBpp0077259 FBpp0077259 FBpp0077260 NP_523467.1.81976 NP_722907.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]