SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077551 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077551
Domain Number 1 Region: 150-226
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.69e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.00071
Further Details:      
 
Domain Number 2 Region: 62-154
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3e-19
Family Cold shock DNA-binding domain-like 0.00027
Further Details:      
 
Domain Number 3 Region: 5-62
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 8.79e-18
Family ECR1 N-terminal domain-like 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077551   Gene: FBgn0260648   Transcript: FBtr0077883
Sequence length 232
Comment pep:known chromosome:BDGP5:2L:1728732:1729575:1 gene:FBgn0260648 transcript:FBtr0077883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSATSTIVMPGERIAAIEELAKSKRVILGPGLRRLDDTVVASKAGPLRHKEPGTFWVDNY
QRRYIPARGDLILGIVRAKAGDLYRVDIGATDTASISYLAFEAASKKNRPDLIPGDLIYA
RVLNASADIEPELVCVNSVGKSGKLGVLTDGFFFKCSLNLGRMLLRENCPVLAALTRELP
YEIAVGVNGRIWLKAHSLKETVALANAISALEQSGCAEIDKICGNLGDFLQA
Download sequence
Identical sequences Q8IPX7
FBpp0077551 7227.FBpp0077551 FBpp0077551 NP_001285565.1.81976 NP_722725.1.81976 FBpp0077551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]