SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0078086 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0078086
Domain Number 1 Region: 3-146
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.8e-48
Family RNA polymerase subunit RBP8 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0078086   Gene: FBgn0037121   Transcript: FBtr0078432
Sequence length 149
Comment pep:known chromosome:BDGP5:3L:21722032:21722794:1 gene:FBgn0037121 transcript:FBtr0078432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGVLFEDIFNVKDMDPEGKKFDRVSRLHCESESFKMDLILDINSWLYPMELGDKFRLVL
ATTLREDGCPDSGEYNPMEHEGTRADSFEYVMYGKIYRIEGDEAHNEASRLSAYVSFGGL
LMRLQGDANNLHGFEVDQHMYLLMKRLAF
Download sequence
Identical sequences A0A1W4UEQ1 B3NIY5 B4GRW5 B4IAU7 B4ITD0 B4QK93 Q2M0A5 Q9VNZ3
7227.FBpp0078086 7237.FBpp0274479 7245.FBpp0264797 7245.FBpp0268041 NP_649352.1.81976 XP_001353518.1.19638 XP_001973676.1.56816 XP_002021344.1.64850 XP_002040857.1.34323 XP_002086242.1.41174 XP_002095266.1.41174 XP_015014158.1.56816 XP_016032887.1.80810 XP_016937931.1.48971 XP_016940196.1.48971 XP_016959609.1.21709 XP_016990824.1.97277 XP_017001253.1.47939 XP_017016329.1.37106 XP_017042398.1.74164 XP_017042399.1.74164 XP_017072467.1.81094 XP_017109424.1.53830 XP_017123083.1.32376 XP_017137781.1.22881 XP_020799920.1.32911 FBpp0203878 FBpp0078086 FBpp0213391 DS10_00009076 DS10_00011798 FBpp0264797 FBpp0268041 FBpp0134764 7296484___KOG3400 FBpp0188964 FBpp0274479 FBpp0078086 FBpp0078086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]