SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0078830 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0078830
Domain Number 1 Region: 7-69
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000341
Family ZZ domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0078830   Gene: FBgn0051642   Transcript: FBtr0079199
Sequence length 557
Comment pep:known chromosome:BDGP5:2L:6118512:6120522:1 gene:FBgn0051642 transcript:FBtr0079199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHQMRNPPERHFGHRCENCKISDFQGRRYTCRFCAEYTLCGKCFDANHLPASPQHRYYH
PMSVYYAYAEYQLYFGGEPFCGDHKVAQSYKCALCDVRGLSTAHLFMHLLQEHRDHRDHD
AYLSLVNTLYIADNGMEQQVPVPQPSSQTRSTRSRNLASVRPVAGGNTRSEQRTEQVFDS
ALSLALMVVQLDNMDSTAADFPERCYEILQQTETVLMQHRSSRVPDMEAIESFVRVIEDQ
VVTSMADRRQRLGASSSSLHRLTRIEAISPGTNTALAMGMRAAMPVLVDQPTTMVRRQTA
RRTGEPIGIALQSAVASSSRSGKAGSSSGVAKAQTKTQGDQPTKKVSTVITSPLKDKRFL
CSKLVSGNGQKWESKLLKATFTEAMFCSMLADEELFQPPIGLPWTANFMLDAVEPSGSVK
SNGKLLLYPVKTKELMERFYRGLAEYKTWIGYQTEPTAESKATELPSASTSSAYFTVLGD
IPYADSGSDDLESNASEEMASDLHGEGNSDDLAGLEEDKESGEEENGDEDDGASDSDFSE
SAISQITDFIDMVIQDE
Download sequence
Identical sequences Q8IPJ9
FBpp0078830 FBpp0078830 NP_723159.1.81976 7227.FBpp0078830 FBpp0078830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]