SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0079665 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0079665
Domain Number 1 Region: 482-573,631-834
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 4.94e-42
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.073
Further Details:      
 
Domain Number 2 Region: 94-203
Classification Level Classification E-value
Superfamily TPR-like 5.04e-20
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 
Weak hits

Sequence:  FBpp0079665
Domain Number - Region: 5-132
Classification Level Classification E-value
Superfamily TPR-like 0.000601
Family Tetratricopeptide repeat (TPR) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0079665   Gene: FBgn0260749   Transcript: FBtr0080076
Sequence length 939
Comment pep:known chromosome:BDGP5:2L:10272325:10277551:-1 gene:FBgn0260749 transcript:FBtr0080076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKHCGEFHIALKHLQLALLYTYPSTFSELQVKFQIAHLYEVQNKHKAAKDGYEFLLNEK
NISLELKADVYRQLGWMYHCVECLGEKKEREANALNFLQKSIEADPKSGQSLYLLGRCYA
GINKVHDAFLAYRNSVEKSEGNADTWCSIGVLYQQQNQPTDALQAYICAVQLDKDHKAAW
TNLGILYESCGQLRDAYACYLNATKQISFQKSSLIRKKQAIRMKKDTIGLSKGLSQRITF
LEGQLSQAPLPSITSKRRQLCSIEEAWNLPISLEMNSRQQQTAQMLPRQVTKQSPVQGPP
PPYPHSQLSQSPIPSKRIKEDGTSQQEVTQNNSQTSAQNLINISESLNQRNFNAMPESNK
SSEQSVLDTFDDISNDIYKQNESIKLERLSQDALSNNEDSRHDFIGGDNADISTTFKIQM
DSKQLMVAVKLLPIDEPPVHCTILQVNAPPPSPPDCPPQKLTRDQLLPPTPSVHLENKKH
AFSPQLQEFCLKHPIAVVRGLAGVLKLDLGLFSTKTLVEANPDHSVEVRTQVHQSPDENW
DTSQGKRVWACISHRSHTTIAKYAQYQASSFQDSLKLILPQDESDKGFPGSQAMSDSDSK
DSVSNSNIVLKRKKHKINSKMLRFGTNVDLSDEKKWKPQLTELQKLPAFARVISAANMLS
HVGHVILGMNTVQLYMKVPGSRTPGHQENNNFCSININIGPGDCEWFAVPDAYWGGVHNL
CEKNNISYLHGSWWPVLEDLYKENIPVYRFIQKPGDLVWVNAGCVHWVQSIGWCNNIAWN
VGPLTARQYSLAIERYEWNKVQAFKSIVPMVHLSWNLARNIKVSDTKLFELIKMCLLQTL
KNVLHIQEYVKSKGVEIRFNGRGKNEASHYCGQCEVEVFNVLFIKEQEKRHVVHCLSCAL
KLSPSLQGIVCLEEYRLSELQRVYDSFTLHRTQGLAYTQ
Download sequence
Identical sequences Q76NQ3
NP_723550.2.81976 NP_723551.2.81976 FBpp0079665 FBpp0079666 FBpp0079665 FBpp0079666 FR752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]