SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0079977 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0079977
Domain Number 1 Region: 127-338
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.36e-60
Family Arfaptin, Rac-binding fragment 0.001
Further Details:      
 
Domain Number 2 Region: 7-85
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-17
Family PDZ domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0079977   Gene: FBgn0032447   Transcript: FBtr0080396
Sequence length 487
Comment pep:known chromosome:BDGP5:2L:12696116:12698917:1 gene:FBgn0032447 transcript:FBtr0080396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVSTNAVVITKDQSNLIGISIGGGAPMCPCLYIVQIFDGTPAAREGSLQSGDELLAVNS
VSVKGKTKVEVAKMIQTATDEVVIHYNKLHADPEQGKTLDIILKKLKHRIVDNLSSNTAD
TLGLSRAILCNDSLVKRLEELEGTELMYKGLVEHARRMLKAYYDLLQTYKSFGDCFTQIS
VHEPQQRASEAFRTFGEFHRTLEKDGLGIIKQIKPVLADLGTYLNKAIPDTKLTVRRYAD
AKFTYLSYCLKVKEMDDEEHGFAALQEPLYRVETGNYEYRLILRCRQDARSKFAKLRTDV
LEKMELLECKHAMDLNKQLRSLLESLAELHRSLVDRLDSLPPLFPIEVDFKETDFQYKSS
TLKPQELDDDEIEANNHPHSTPSQVDCGFEAVEQPAAIINVEAAKASVDSSTLQSASENE
TLLKELGLYDVDLLSNPQTISNQKDSIAAQNDGYDFDLFLNQATAATTSLERDLMSSNAE
EMDLLLQ
Download sequence
Identical sequences Q86PF5
NP_001246009.2.81976 NP_001285880.1.81976 NP_723766.1.81976 FBpp0079977 FBpp0079977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]