SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080449 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080449
Domain Number 1 Region: 213-515
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.72e-38
Family NodB-like polysaccharide deacetylase 0.014
Further Details:      
 
Domain Number 2 Region: 108-157
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000023
Family Tachycitin 0.027
Further Details:      
 
Domain Number 3 Region: 169-202
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000694
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080449   Gene: FBgn0032598   Transcript: FBtr0080892
Sequence length 577
Comment pep:known chromosome:BDGP5:2L:16738852:16742610:1 gene:FBgn0032598 transcript:FBtr0080892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCPGENAYNANGQTGFTVKVVASAQRRSKPQPTARIPNAHRLPSLCIWMMVALMIMSSS
LDALVIDNDGIVGNQTRHRRSTSGAASCMQDARFYRNPNRPVHKIWTNSECAKYFLCLDG
EVFEFKCSEGLLFDVVRQICDFKANVDNCDVSAETPAPKPLLEMADCADEYQLGCADGTC
LPQEYFCDGSVDCPDGSDEGWCDVEHDPNAAGACDPRKCHLPQCFCSKDGTQIPGSLPAQ
SVPQMILLTFDDAINHDNWELFSKVLFTQHRRNPNGCPIKGTFYVSHPFTNYQYVQKLWN
DGHEIAVHSVTHRGPEMWWSKNATIEDWFDEMVGQANIINKFAAVRMEEIRGMRVPFLRV
GWNRQFLMMKEFGFVYDSSMVAPHSNPPLWPYTLDYKMPHSCTGVNQNCPSRSYPGIWEL
VMNQLEVGEYMCGMVDTCPPHLSGEDVYRMLTHNFKRHYLSNRAPFGLYFHSTWFKKVDY
LNAFLKFLDDLQKLPDVFFVTNQQAIQWMRHPTPSNQLHQFESWHCQPKDLDPHEQVCNT
PNVCKVRSRVLQEDRFFYTCMECPAQYPWIRNEFGLD
Download sequence
Identical sequences Q9VJI8
FBpp0080449 FBpp0080449 7227.FBpp0080449 NP_609806.1.81976 FBpp0080449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]